Gene Information

Name : yeeW (EC55989_4896)
Accession : YP_002405753.1
Strain : Escherichia coli 55989
Genome accession: NC_011748
Putative virulence/resistance : Virulence
Product : hypothetical protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 5003122 - 5003610 bp
Length : 489 bp
Strand : +
Note : Evidence 4 : Homologs of previously reported genes of unknown function

DNA sequence :
ATGAAACTGGCCCTGACGCTGGAAGCCGACAGCATTAACGTGCAGGCACTGAACATGGGGCGCATTGTCGTTGACGTCGA
TGGTGTTACTCTCGCTGAACTGATTAACGTGGTCTGCGATAACGGTTACTCCCTTCGTGTTGTTGATGAATCTGACCGGA
CATCAGCAGAGCGCACGCCACCATCTGCGGCCCTTACCGGCATACGCTGCAGTACCGCACATATCACGGAAACGGACAAT
GCCTGGTTGTACTCGCTGTCAAATCAGACGAATGACACCGGCGAATCAGAATGGATTCATTTCACAGGTAGCGGATATCT
GTTACGTACCGATGCGTGGTCATACCCGGTTCTGCGGCTTAAACGCCTGGGGCTGTCCAGAACGTTCCGCCGTCTGGTTG
TCACACTCATCCGGCGTTATGGCGTCAGTCTCATTCATCTGGATGCCGGTGCTGAATGTCTGCAGGATTTACCCACTTTC
AACTGGTAA

Protein sequence :
MKLALTLEADSINVQALNMGRIVVDVDGVTLAELINVVCDNGYSLRVVDESDRTSAERTPPSAALTGIRCSTAHITETDN
AWLYSLSNQTNDTGESEWIHFTGSGYLLRTDAWSYPVLRLKRLGLSRTFRRLVVTLIRRYGVSLIHLDAGAECLQDLPTF
NW

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42102.1 hypothetical protein Not tested PAI II 536 Protein 1e-67 95
Z1223 NP_286758.1 hypothetical protein Not tested TAI Protein 1e-64 90
unnamed AAC31487.1 L0008 Not tested LEE Protein 7e-65 90
Z1662 NP_287164.1 hypothetical protein Not tested TAI Protein 1e-64 90
unnamed ACU09434.1 conserved hypothetical protein Not tested LEE Protein 7e-65 90
Z5092 NP_290243.1 hypothetical protein Not tested LEE Protein 1e-64 90
ECs4540 NP_312567.1 hypothetical protein Not tested LEE Protein 1e-64 90
unnamed CAD66208.1 hypothetical protein Not tested PAI III 536 Protein 7e-64 90
unnamed AAL08479.1 unknown Not tested SRL Protein 9e-64 89
c5148 NP_756996.1 hypothetical protein Not tested PAI II CFT073 Protein 5e-62 88
unnamed CAI43904.1 hypothetical protein Not tested LEE Protein 9e-63 88
unnamed AAL57574.1 unknown Not tested LEE Protein 5e-56 87
z5092 CAD33790.1 Z5092 protein Not tested PAI I 536 Protein 5e-62 87
yeeW CAE85205.1 YeeW protein Not tested PAI V 536 Protein 2e-61 86
yeeW AAZ04462.1 conserved hypothetical protein Not tested PAI I APEC-O1 Protein 9e-60 84
yeeW ADD91698.1 YeeW Not tested PAI-I AL862 Protein 2e-61 84
APECO1_3485 YP_854326.1 hypothetical protein Not tested PAI I APEC-O1 Protein 1e-59 84
yeeW NP_838488.1 hypothetical protein Not tested SHI-1 Protein 2e-61 84
yeeW NP_708774.1 hypothetical protein Not tested SHI-1 Protein 2e-61 84
aec77 AAW51760.1 Aec77 Not tested AGI-3 Protein 7e-59 83
yeeW CAI43849.1 YeeW protein Not tested LEE Protein 7e-60 83
unnamed AAK00483.1 unknown Not tested SHI-1 Protein 2e-54 83
unnamed AAL67388.1 L0008-like protein Not tested PAI II CFT073 Protein 3e-51 82
ECO103_3593 YP_003223450.1 hypothetical protein Not tested LEE Protein 1e-59 81

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
yeeW YP_002405753.1 hypothetical protein VFG1621 Protein 5e-68 95
yeeW YP_002405753.1 hypothetical protein VFG0787 Protein 3e-65 90
yeeW YP_002405753.1 hypothetical protein VFG1683 Protein 3e-64 90
yeeW YP_002405753.1 hypothetical protein VFG1070 Protein 4e-64 89
yeeW YP_002405753.1 hypothetical protein VFG1531 Protein 2e-62 87
yeeW YP_002405753.1 hypothetical protein VFG0664 Protein 7e-62 84