Gene Information

Name : yeeV (ECIAI39_4244)
Accession : YP_002410118.1
Strain : Escherichia coli IAI39
Genome accession: NC_011750
Putative virulence/resistance : Virulence
Product : toxin of the YeeV-YeeU toxin-antitoxin system; CP4-44 prophage
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 4413241 - 4413618 bp
Length : 378 bp
Strand : +
Note : Evidence 1b : Function experimentally demonstrated in the studied species; PubMedId : 14594833; Product type h : extrachromosomal origin

DNA sequence :
ATGAAAACATTACCTGTATTACCCGGGCAGGCGGCCAGTTCACGCCCGTCTCCGGTTGAAATCTGGCAGACACTGCTCAC
CCGACTGCTGGATCAGCACTACGGCCTTACGCTGAATGACACACCGTTCGCTGATGAACGTGTGATTGAGCAGCATATTG
AGGCAGGCATTTCACTGTGCGATGCGGTGAACTTTCTCGTTGAAAAATACGCGCTGGTACGTACCGACCAGCCGGGATTC
AGCACCTGTACCCACTCTCAGTTAATAAACAGCATCGATATCCTCCGGGCCCGCCGGGCGACAGGCCTGATGACCCGCGA
CAATTACAGAATGGTAAATGACATTAGCCAGGGGAAGTATCCGGAGGCGAAACAATGA

Protein sequence :
MKTLPVLPGQAASSRPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCTHSQLINSIDILRARRATGLMTRDNYRMVNDISQGKYPEAKQ

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD66207.1 hypothetical protein Not tested PAI III 536 Protein 2e-46 88
yeeV CAE85204.1 YeeV protein Not tested PAI V 536 Protein 2e-47 88
c5149 NP_756997.1 hypothetical protein Not tested PAI II CFT073 Protein 4e-46 87
unnamed AAL57575.1 unknown Not tested LEE Protein 7e-46 87
unnamed AAL67389.1 L0007-like protein Not tested PAI II CFT073 Protein 3e-46 87
z5091 CAD33789.1 Z5091 protein Not tested PAI I 536 Protein 5e-46 86
yeeV YP_854325.1 hypothetical protein Not tested PAI I APEC-O1 Protein 5e-46 86
yeeV AAZ04461.1 conserved hypothetical protein Not tested PAI I APEC-O1 Protein 5e-45 86
unnamed AAC31486.1 L0007 Not tested LEE Protein 1e-45 85
unnamed ACU09433.1 conserved hypothetical protein Not tested LEE Protein 1e-45 85
yeeV ADD91699.1 YeeV Not tested PAI-I AL862 Protein 4e-46 85
unnamed CAI43848.1 hypothetical protein Not tested LEE Protein 2e-45 85
aec76 AAW51759.1 Aec76 Not tested AGI-3 Protein 2e-45 85
Z5091 NP_290242.1 hypothetical protein Not tested LEE Protein 2e-45 85
unnamed AAL67342.1 intergenic-region protein Not tested PAI II CFT073 Protein 2e-45 85
ECs4539 NP_312566.1 hypothetical protein Not tested LEE Protein 2e-45 85
unnamed AAL08478.1 unknown Not tested SRL Protein 1e-45 85
unnamed AAK00482.1 unknown Not tested SHI-1 Protein 4e-45 84
ECO103_3592 YP_003223449.1 hypothetical protein Not tested LEE Protein 3e-43 84
unnamed CAD42101.1 hypothetical protein Not tested PAI II 536 Protein 4e-45 84
yeeV NP_838487.1 hypothetical protein Not tested SHI-1 Protein 6e-45 84
yeeV NP_708773.1 hypothetical protein Not tested SHI-1 Protein 6e-45 84

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
yeeV YP_002410118.1 toxin of the YeeV-YeeU toxin-antitoxin system; CP4-44 prophage VFG1682 Protein 8e-47 88
yeeV YP_002410118.1 toxin of the YeeV-YeeU toxin-antitoxin system; CP4-44 prophage VFG1530 Protein 2e-46 86
yeeV YP_002410118.1 toxin of the YeeV-YeeU toxin-antitoxin system; CP4-44 prophage VFG1069 Protein 4e-46 85
yeeV YP_002410118.1 toxin of the YeeV-YeeU toxin-antitoxin system; CP4-44 prophage VFG0786 Protein 4e-46 85
yeeV YP_002410118.1 toxin of the YeeV-YeeU toxin-antitoxin system; CP4-44 prophage VFG1620 Protein 2e-45 84
yeeV YP_002410118.1 toxin of the YeeV-YeeU toxin-antitoxin system; CP4-44 prophage VFG0663 Protein 2e-45 84