Gene Information

Name : insC (ECUMN_3359)
Accession : YP_002414034.1
Strain : Escherichia coli UMN026
Genome accession: NC_011751
Putative virulence/resistance : Unknown
Product : IS2 insertion element repressor InsA; KpLE2 phage-like element
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG2963
EC number : -
Position : 3473915 - 3474289 bp
Length : 375 bp
Strand : -
Note : Evidence 1b : Function experimentally demonstrated in the studied species; PubMedId : 9689094; Product type r : regulator

DNA sequence :
GTGATAGTCTTAATACTAGTTTTTAGACTAGTCATTGGAGAACAGATGATTGATGTCTTAGGACCGGAGAAACGCAGACG
GCGTACTACACAGGAAAAGATCGCTATTGTTCAGCAGAGCTTTGAACCGGGAATGACGGTCTCCCTTGTTGCCCGGCAAC
ATGGTGTGGCAGCCAGCCAGTTATTTCTCTGGCGCAAGCAATACCAGGAGGGAAGTCTTAGTGCTGTGGCCGCAGGAGAA
CAGGTCGTTCCTGCCTCTGAACTTGCTGCTGCCATGAAGCAGATTAAAGAACTCCAGCGCCTGCTCGGTAAAAAACGATG
GAAAATGAACTCCTTAAAGAAGCCGTTGAATATGGGCGTGCAAAAAAGTGGATAG

Protein sequence :
MIVLILVFRLVIGEQMIDVLGPEKRRRRTTQEKIAIVQQSFEPGMTVSLVARQHGVAASQLFLWRKQYQEGSLSAVAAGE
QVVPASELAAAMKQIKELQRLLGKKRWKMNSLKKPLNMGVQKSG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed AAL67376.1 insertion sequence protein Not tested PAI II CFT073 Protein 1e-46 100
insC YP_002414034.1 IS2 insertion element repressor InsA; KpLE2 phage-like element Not tested Not named Protein 7e-54 100
tnpG AAD44740.1 TnpG Not tested SHI-2 Protein 1e-36 99
ECO26_5247 YP_003232129.1 insertion sequence 2 OrfA protein Not tested LEE Protein 2e-36 99
unnamed AAL57520.1 IS2 transposase Not tested LEE Protein 1e-36 99
S3188 NP_838471.2 insertion sequence 2 OrfA protein Not tested SHI-1 Protein 2e-36 99
S4060 NP_839229.2 insertion sequence 2 OrfA protein Not tested SHI-2 Protein 2e-36 99
st02 CAC81840.1 ST02 protein Not tested LEE II Protein 1e-36 99
SF2984 NP_708758.3 IS2 ORF1 Not tested SHI-1 Protein 2e-43 90
SF3709 NP_709448.3 IS2 ORF1 Not tested SHI-2 Protein 6e-44 90
SF3722 NP_709461.3 IS2 ORF1 Not tested SHI-2 Protein 6e-44 90
aec50 AAW51733.1 Aec50 Not tested AGI-3 Protein 2e-44 90
S4049 NP_839217.2 insertion sequence 2 OrfA protein Not tested SHI-2 Protein 6e-37 90

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
insC YP_002414034.1 IS2 insertion element repressor InsA; KpLE2 phage-like element VFG1733 Protein 2e-54 100
insC YP_002414034.1 IS2 insertion element repressor InsA; KpLE2 phage-like element VFG0648 Protein 5e-44 90
insC YP_002414034.1 IS2 insertion element repressor InsA; KpLE2 phage-like element VFG0622 Protein 2e-44 90
insC YP_002414034.1 IS2 insertion element repressor InsA; KpLE2 phage-like element VFG0609 Protein 2e-44 90