Name : VS_1654 (VS_1654) Accession : YP_002417265.1 Strain : Genome accession: NC_011753 Putative virulence/resistance : Virulence Product : prophage protein; DNA-binding protein Function : - COG functional category : K : Transcription COG ID : COG3311 EC number : - Position : 1787719 - 1787934 bp Length : 216 bp Strand : - Note : Evidence 3 : Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; Product type pr : regulator DNA sequence : ATGAGGACCACAGGCATAGGAGAACGTCCCATGAGATTTTTAAAGCTAAAAGAAGTGATTGAGAAAACTGCATTAAGCCG CTCGGCGATATACAGAAAAATGGACGAAGGTAATTTTCCTGTATCGGTAAGCTTGGGAGATAGGGCGGTCGCTTGGGTAG AAGAAGAGGTGAATAACTGGATGGAAATGCGCTTGGCTGAAAGACCAAGCCATTAA Protein sequence : MRTTGIGERPMRFLKLKEVIEKTALSRSAIYRKMDEGNFPVSVSLGDRAVAWVEEEVNNWMEMRLAERPSH |
Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
VPI2_0033 | AAX20900.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 2e-20 | 71 |
VC1785 | NP_231420.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 3e-20 | 71 |
VC0395_A1382 | YP_001217325.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 3e-20 | 71 |
VC0497 | NP_230151.1 | transcriptional regulator | Not tested | VSP-2 | Protein | 2e-13 | 59 |
PMI2608 | YP_002152324.1 | prophage regulatory protein | Not tested | Not named | Protein | 5e-09 | 47 |
VC1809 | NP_231443.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 1e-12 | 45 |
VC0395_A1406 | YP_001217349.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 1e-12 | 45 |
unnamed | CAA21398.1 | - | Not tested | HPI | Protein | 5e-10 | 44 |
unnamed | CAB46594.1 | DNA-binding protein | Not tested | HPI | Protein | 4e-10 | 44 |
VPI2_0041 | ACA01856.1 | predicted transcriptional regulator | Not tested | VPI-2 | Protein | 3e-12 | 43 |
ORF SG104 | AAN62325.1 | phage-related protein | Not tested | PAGI-3(SG) | Protein | 3e-08 | 42 |
Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
VS_1654 | YP_002417265.1 | prophage protein; DNA-binding protein | VFG1118 | Protein | 1e-20 | 71 |
VS_1654 | YP_002417265.1 | prophage protein; DNA-binding protein | VFG1141 | Protein | 4e-13 | 45 |