Gene Information

Name : Cagg_1100 (Cagg_1100)
Accession : YP_002462446.1
Strain : Chloroflexus aggregans DSM 9485
Genome accession: NC_011831
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1357898 - 1358608 bp
Length : 711 bp
Strand : -
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: cau:Caur_2863 response regulator receiver

DNA sequence :
ATGGCGACGGTTTTGATTGTCGAAGACGAGACGACACTGGCCGAAACACTACGCTACAATCTTGAACGAGAAGGGTATGC
GGTCATTATCGCCGGCGATGGCGTACAAGGGCTTGATCGTGCCCGCCGTGATCAGCCCGATCTCGTGGTGCTCGATATTA
TGCTACCCCGCCTTGATGGATTTTCGGTCTGTCGGATTCTACGCCAAGAGAGTGACGTACCGATAATCATGCTTACCGCC
CGCCAAGATGAAGTTGATCGGATTGCCGGTCTCGAACTCGGCGCCGATGACTACATCAGCAAACCGTTTAGCCTCGGTGA
GTTTCTTGCGCGCGTGCGGGCTATTTTGCGCCGTAGTGAACGGCAGCCGCATTCGATTGTGCGTGAAGTCCTCGAGGCAG
GTTCGATCCGGGTTGATGCCAGTAGCCGTCGTGCATGGCGTGATGGTCAAGAACTAAACCTGCCGCAAAAGGAGTTCGAC
CTCCTGACGTGTCTTATGCGCAACCGTGGCATCGCTCTGACCCGCGATCTGTTGCTCGAACGAGTATGGGGGCAGGATTT
TATCGGTGATAGCCGCACCGTCGATGTCCATATTCGCTGGTTGCGTGAGAAGATTGAACCTGATCCCAGTAAGCCAACGT
ATATCCAGACGGTGCGTGGTGTTGGGTACCGATTTGAACCTCCGGTTGACGGGACAACAATAAGCCAATGA

Protein sequence :
MATVLIVEDETTLAETLRYNLEREGYAVIIAGDGVQGLDRARRDQPDLVVLDIMLPRLDGFSVCRILRQESDVPIIMLTA
RQDEVDRIAGLELGADDYISKPFSLGEFLARVRAILRRSERQPHSIVREVLEAGSIRVDASSRRAWRDGQELNLPQKEFD
LLTCLMRNRGIALTRDLLLERVWGQDFIGDSRTVDVHIRWLREKIEPDPSKPTYIQTVRGVGYRFEPPVDGTTISQ

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 6e-32 43
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 4e-32 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Cagg_1100 YP_002462446.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 5e-52 49
Cagg_1100 YP_002462446.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 5e-52 49
Cagg_1100 YP_002462446.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 5e-52 49
Cagg_1100 YP_002462446.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 5e-52 49
Cagg_1100 YP_002462446.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 5e-52 49
Cagg_1100 YP_002462446.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 5e-52 49
Cagg_1100 YP_002462446.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 5e-52 49
Cagg_1100 YP_002462446.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 5e-52 49
Cagg_1100 YP_002462446.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 5e-52 49
Cagg_1100 YP_002462446.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 8e-52 48
Cagg_1100 YP_002462446.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 3e-45 48
Cagg_1100 YP_002462446.1 winged helix family two component transcriptional regulator AE016830.1.gene1681. Protein 3e-51 47
Cagg_1100 YP_002462446.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 6e-50 46
Cagg_1100 YP_002462446.1 winged helix family two component transcriptional regulator HE999704.1.gene1528. Protein 4e-40 45
Cagg_1100 YP_002462446.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 5e-49 45
Cagg_1100 YP_002462446.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 3e-41 44
Cagg_1100 YP_002462446.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 3e-41 44
Cagg_1100 YP_002462446.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 3e-41 44
Cagg_1100 YP_002462446.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 3e-41 44
Cagg_1100 YP_002462446.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 3e-41 44
Cagg_1100 YP_002462446.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 3e-41 44
Cagg_1100 YP_002462446.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 3e-41 44
Cagg_1100 YP_002462446.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 3e-41 44
Cagg_1100 YP_002462446.1 winged helix family two component transcriptional regulator AE015929.1.gene1106. Protein 2e-39 44
Cagg_1100 YP_002462446.1 winged helix family two component transcriptional regulator BAC0125 Protein 4e-38 44
Cagg_1100 YP_002462446.1 winged helix family two component transcriptional regulator BAC0197 Protein 3e-36 44
Cagg_1100 YP_002462446.1 winged helix family two component transcriptional regulator BAC0111 Protein 3e-39 43
Cagg_1100 YP_002462446.1 winged helix family two component transcriptional regulator NC_012469.1.7686381. Protein 5e-46 43
Cagg_1100 YP_002462446.1 winged helix family two component transcriptional regulator CP001918.1.gene3444. Protein 1e-35 43
Cagg_1100 YP_002462446.1 winged helix family two component transcriptional regulator BAC0083 Protein 2e-37 42
Cagg_1100 YP_002462446.1 winged helix family two component transcriptional regulator CP000034.1.gene3671. Protein 7e-39 42
Cagg_1100 YP_002462446.1 winged helix family two component transcriptional regulator NC_011595.7057856.p0 Protein 6e-40 41
Cagg_1100 YP_002462446.1 winged helix family two component transcriptional regulator NC_010410.6002989.p0 Protein 6e-40 41
Cagg_1100 YP_002462446.1 winged helix family two component transcriptional regulator BAC0308 Protein 9e-35 41
Cagg_1100 YP_002462446.1 winged helix family two component transcriptional regulator BAC0347 Protein 1e-35 41
Cagg_1100 YP_002462446.1 winged helix family two component transcriptional regulator CP001485.1.gene721.p Protein 1e-36 41
Cagg_1100 YP_002462446.1 winged helix family two component transcriptional regulator CP004022.1.gene1676. Protein 1e-32 41
Cagg_1100 YP_002462446.1 winged helix family two component transcriptional regulator CP000647.1.gene2531. Protein 2e-35 41
Cagg_1100 YP_002462446.1 winged helix family two component transcriptional regulator CP000034.1.gene2186. Protein 5e-36 41
Cagg_1100 YP_002462446.1 winged helix family two component transcriptional regulator NC_002695.1.916589.p Protein 3e-36 41
Cagg_1100 YP_002462446.1 winged helix family two component transcriptional regulator BAC0596 Protein 1e-34 41
Cagg_1100 YP_002462446.1 winged helix family two component transcriptional regulator BAC0039 Protein 5e-36 41
Cagg_1100 YP_002462446.1 winged helix family two component transcriptional regulator CP001138.1.gene2239. Protein 1e-34 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Cagg_1100 YP_002462446.1 winged helix family two component transcriptional regulator VFG1389 Protein 5e-37 46
Cagg_1100 YP_002462446.1 winged helix family two component transcriptional regulator VFG1390 Protein 5e-40 44
Cagg_1100 YP_002462446.1 winged helix family two component transcriptional regulator VFG0596 Protein 2e-32 43
Cagg_1100 YP_002462446.1 winged helix family two component transcriptional regulator VFG1386 Protein 6e-41 43