Gene Information

Name : Cagg_1351 (Cagg_1351)
Accession : YP_002462694.1
Strain : Chloroflexus aggregans DSM 9485
Genome accession: NC_011831
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1676209 - 1676886 bp
Length : 678 bp
Strand : -
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: cau:Caur_2506 response regulator receiver

DNA sequence :
ATGACGCGCATACTCATTATTGAAGATGAAACTGAAATTGCTTCTTACCTACGGCGTGGTCTAAGCCTTGAAGGCTATCA
CGTTGATGTGGCGTTCGATGGGTTGCAAGGGTTGGAGATGGCCTCAACCGGCAATTACGATCTCGTCGTACTTGACTTAA
TGCTGCCGGTGATCGATGGCTTCGAGGTAGCGCGCCGTATCCGCGCCGCGTCAAATGTCCCGATCATTATGCTGACGGCC
CGTGATGCTGTGCGTGATCGGGTGGCCGGCCTTGAAGCAGGTGCTGATGATTATCTGGTAAAACCGTTTGCGTTTGAAGA
GTTATTGGCCCGCATCCGTGCCCAACTGCGCCGTCAACAGACGTATCAGCACCAAGAGGTGCTTCGGTTTGCGAATTTGA
CGCTTGATACCCGTTCACGTGAGTTGCGCGTGGGAGACCGTCGTGTTGAGCTAACGGCCAAAGAATACGACCTGCTTGAA
CTCTTTATGCGTCACCCCAATCAGGTGTTGACCCGTGACGTTATTTACGATCGGGTATGGAATTACGATTTTGGGGGAGA
GAGCAATATCATCGAAGTGTATGTGCGCTATCTGCGCCAAAAGCTAGAAGCGAATGGCGAACCTCGGCTTATCCACACGG
TGCGTAGTGTAGGCTATATTTTGCGGGAGGATGCGTAG

Protein sequence :
MTRILIIEDETEIASYLRRGLSLEGYHVDVAFDGLQGLEMASTGNYDLVVLDLMLPVIDGFEVARRIRAASNVPIIMLTA
RDAVRDRVAGLEAGADDYLVKPFAFEELLARIRAQLRRQQTYQHQEVLRFANLTLDTRSRELRVGDRRVELTAKEYDLLE
LFMRHPNQVLTRDVIYDRVWNYDFGGESNIIEVYVRYLRQKLEANGEPRLIHTVRSVGYILREDA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 2e-36 44

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Cagg_1351 YP_002462694.1 winged helix family two component transcriptional regulator BAC0197 Protein 4e-42 51
Cagg_1351 YP_002462694.1 winged helix family two component transcriptional regulator HE999704.1.gene1528. Protein 7e-45 48
Cagg_1351 YP_002462694.1 winged helix family two component transcriptional regulator BAC0308 Protein 5e-43 48
Cagg_1351 YP_002462694.1 winged helix family two component transcriptional regulator BAC0125 Protein 1e-43 48
Cagg_1351 YP_002462694.1 winged helix family two component transcriptional regulator BAC0083 Protein 7e-44 48
Cagg_1351 YP_002462694.1 winged helix family two component transcriptional regulator BAC0638 Protein 1e-36 48
Cagg_1351 YP_002462694.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 6e-43 47
Cagg_1351 YP_002462694.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 6e-43 47
Cagg_1351 YP_002462694.1 winged helix family two component transcriptional regulator AE015929.1.gene1106. Protein 3e-36 47
Cagg_1351 YP_002462694.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 6e-43 47
Cagg_1351 YP_002462694.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 6e-43 47
Cagg_1351 YP_002462694.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 6e-43 47
Cagg_1351 YP_002462694.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 6e-43 47
Cagg_1351 YP_002462694.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 6e-43 47
Cagg_1351 YP_002462694.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 6e-43 47
Cagg_1351 YP_002462694.1 winged helix family two component transcriptional regulator BAC0111 Protein 4e-44 47
Cagg_1351 YP_002462694.1 winged helix family two component transcriptional regulator BAC0347 Protein 3e-40 46
Cagg_1351 YP_002462694.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 2e-33 43
Cagg_1351 YP_002462694.1 winged helix family two component transcriptional regulator NC_002516.2.879194.p Protein 1e-23 41
Cagg_1351 YP_002462694.1 winged helix family two component transcriptional regulator FJ349556.1.orf0.gene Protein 5e-30 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Cagg_1351 YP_002462694.1 winged helix family two component transcriptional regulator VFG1390 Protein 4e-52 53
Cagg_1351 YP_002462694.1 winged helix family two component transcriptional regulator VFG1389 Protein 2e-41 46
Cagg_1351 YP_002462694.1 winged helix family two component transcriptional regulator VFG1386 Protein 7e-41 43
Cagg_1351 YP_002462694.1 winged helix family two component transcriptional regulator VFG0473 Protein 5e-25 41