Gene Information

Name : Cagg_3302 (Cagg_3302)
Accession : YP_002464586.1
Strain : Chloroflexus aggregans DSM 9485
Genome accession: NC_011831
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 3999622 - 4000317 bp
Length : 696 bp
Strand : +
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: cau:Caur_2434 response regulator receiver

DNA sequence :
ATGTCCACACCGACGATTCTGATTGTTGATGATGAAGCGCGCTTGCGCGAGTTGGTGCGACGCTATCTCGAGCAGGCCGG
CTTTCGGGTCGTGCAAGCTGCGGACGGAGTGACTGCGCTTGAACAGGCGCGCGCTTGGACTCCTGATGTTGTGATCCTCG
ACATTATGTTGCCGGTGTTGGATGGTCTTGCAGTGTGCCGGCGTTTACGTACCTTTTCCGATGCCTACATTCTCATGTTG
ACGGCTCGGGCCGAGGAGTCTGATCGGGTTACCGGGTTGGAAACAGGAGCCGATGATTATCTTACTAAACCCTTCGCTCC
TCGCGAGTTGGTTGCACGGGTACGAGCCTTGTTACGACGACCACGCCATACAGAGGTGTCAATGCCATCGTCGTTGATTC
ACTATGGTGGTTTGGTGATCGATCCGGTAGCGCATACGGTAGCACTGGATGGGCAGTTGCTCACCCTGACACCAATCGAG
TATGCCTTGCTCTCAGTGATGGCTGCCGCACCCGGACGGGTGTTTTCACGCACGCAATTGCTCGACCGGATATGGGGTCA
TGACTATTTCGGCGATGAGCACGTTGTTGAAGTTCATATCACAAATTTGCGCAAAAAGCTAGGGGATAATCCGAACCGAC
CACAGTATATCTTCACAGTGCGAGGGATCGGTTATCGGTTTGGGGAGCGCCGATGA

Protein sequence :
MSTPTILIVDDEARLRELVRRYLEQAGFRVVQAADGVTALEQARAWTPDVVILDIMLPVLDGLAVCRRLRTFSDAYILML
TARAEESDRVTGLETGADDYLTKPFAPRELVARVRALLRRPRHTEVSMPSSLIHYGGLVIDPVAHTVALDGQLLTLTPIE
YALLSVMAAAPGRVFSRTQLLDRIWGHDYFGDEHVVEVHITNLRKKLGDNPNRPQYIFTVRGIGYRFGERR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 2e-33 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Cagg_3302 YP_002464586.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 6e-36 47
Cagg_3302 YP_002464586.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 5e-36 47
Cagg_3302 YP_002464586.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 5e-36 47
Cagg_3302 YP_002464586.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 5e-36 47
Cagg_3302 YP_002464586.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 5e-36 47
Cagg_3302 YP_002464586.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 6e-36 47
Cagg_3302 YP_002464586.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 4e-36 47
Cagg_3302 YP_002464586.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 5e-36 47
Cagg_3302 YP_002464586.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 5e-36 47
Cagg_3302 YP_002464586.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 5e-36 47
Cagg_3302 YP_002464586.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 2e-36 45
Cagg_3302 YP_002464586.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 7e-36 45
Cagg_3302 YP_002464586.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 1e-37 45
Cagg_3302 YP_002464586.1 winged helix family two component transcriptional regulator NC_012469.1.7686381. Protein 1e-33 44
Cagg_3302 YP_002464586.1 winged helix family two component transcriptional regulator NC_011595.7057856.p0 Protein 8e-31 43
Cagg_3302 YP_002464586.1 winged helix family two component transcriptional regulator NC_010410.6002989.p0 Protein 8e-31 43
Cagg_3302 YP_002464586.1 winged helix family two component transcriptional regulator NC_010400.5986590.p0 Protein 8e-30 43
Cagg_3302 YP_002464586.1 winged helix family two component transcriptional regulator AE016830.1.gene1681. Protein 3e-33 42
Cagg_3302 YP_002464586.1 winged helix family two component transcriptional regulator CP001918.1.gene3444. Protein 2e-30 42
Cagg_3302 YP_002464586.1 winged helix family two component transcriptional regulator BAC0487 Protein 8e-14 42
Cagg_3302 YP_002464586.1 winged helix family two component transcriptional regulator AE015929.1.gene1106. Protein 1e-25 41
Cagg_3302 YP_002464586.1 winged helix family two component transcriptional regulator NC_014475.1.orf0.gen Protein 2e-32 41
Cagg_3302 YP_002464586.1 winged helix family two component transcriptional regulator AF155139.2.orf0.gene Protein 2e-37 41
Cagg_3302 YP_002464586.1 winged helix family two component transcriptional regulator NC_005054.2598277.p0 Protein 2e-32 41
Cagg_3302 YP_002464586.1 winged helix family two component transcriptional regulator HE999704.1.gene1528. Protein 2e-31 41
Cagg_3302 YP_002464586.1 winged helix family two component transcriptional regulator CP004022.1.gene1676. Protein 3e-30 41
Cagg_3302 YP_002464586.1 winged helix family two component transcriptional regulator BAC0596 Protein 8e-30 41
Cagg_3302 YP_002464586.1 winged helix family two component transcriptional regulator CP000034.1.gene2186. Protein 8e-31 41
Cagg_3302 YP_002464586.1 winged helix family two component transcriptional regulator CP001138.1.gene2239. Protein 8e-30 41
Cagg_3302 YP_002464586.1 winged helix family two component transcriptional regulator NC_002695.1.916589.p Protein 7e-31 41
Cagg_3302 YP_002464586.1 winged helix family two component transcriptional regulator BAC0039 Protein 8e-31 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Cagg_3302 YP_002464586.1 winged helix family two component transcriptional regulator VFG1390 Protein 1e-35 45
Cagg_3302 YP_002464586.1 winged helix family two component transcriptional regulator VFG1389 Protein 5e-27 45
Cagg_3302 YP_002464586.1 winged helix family two component transcriptional regulator VFG0473 Protein 4e-13 43
Cagg_3302 YP_002464586.1 winged helix family two component transcriptional regulator VFG1563 Protein 9e-34 41