Gene Information

Name : Cyan7425_3411 (Cyan7425_3411)
Accession : YP_002484096.1
Strain : Cyanothece sp. PCC 7425
Genome accession: NC_011884
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 3365223 - 3365897 bp
Length : 675 bp
Strand : +
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: ava:Ava_0615 two component transcriptional regulator

DNA sequence :
ATGACCGCCCATATTCTTTTGGTTGAAGATGAAGTCAAACTGGCCCGGTTTATTCAACTGGAGCTAGATAGTGAAGGGTA
TCGCGTTACGGTTGCCCACGATGGCATGTCAGGACTTTCTCTAGCCCGCGAAGCCCAACCGGACTTAGCCATTCTGGATT
GGATGCTACCGGGATTAACGGGGATTGAACTCTGTCGGCGACTGCGGGCCACGGGGAATAAGATCCCTGTCATTTTGCTC
ACCGCCCGAGATGAAGTGGGCGATCGGGTGACGGGACTGGATGCTGGAGCAGATGATTATGTGGTCAAACCGTTCAGCAT
CGAAGAATTGCTGGCCCGGATTCGTGCCCACCTGCGCCGCACTCAGGAAGTCGATGAAGATATCCTGCAGTTTGAGGACT
TGAGTTTGAATCGACGCACTCGAGAAGTCCGGCGGGGGCAGCGATCGATTGAACTCACCGCCAAAGAATTTGATTTACTG
GAATACCTGCTCAGCAATCCCCGCCAGGTTTACACCCGCGATCAGATTCTAGAAAAAGTTTGGGGATACGATTTTATGGG
AGATTCCAACATCATTGAGGTTTATGTGCGCTATCTCCGCTTGAAGTTAGAAGAACAGGGCGAAAAACGCTTAATTCATA
CTGTGAGAGGGGTAGGATATGCCTTGCGGGAATAA

Protein sequence :
MTAHILLVEDEVKLARFIQLELDSEGYRVTVAHDGMSGLSLAREAQPDLAILDWMLPGLTGIELCRRLRATGNKIPVILL
TARDEVGDRVTGLDAGADDYVVKPFSIEELLARIRAHLRRTQEVDEDILQFEDLSLNRRTREVRRGQRSIELTAKEFDLL
EYLLSNPRQVYTRDQILEKVWGYDFMGDSNIIEVYVRYLRLKLEEQGEKRLIHTVRGVGYALRE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 5e-36 47
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 2e-35 46

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Cyan7425_3411 YP_002484096.1 winged helix family two component transcriptional regulator HE999704.1.gene1528. Protein 4e-47 50
Cyan7425_3411 YP_002484096.1 winged helix family two component transcriptional regulator AE015929.1.gene1106. Protein 1e-43 49
Cyan7425_3411 YP_002484096.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 9e-47 48
Cyan7425_3411 YP_002484096.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 9e-47 48
Cyan7425_3411 YP_002484096.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 9e-47 48
Cyan7425_3411 YP_002484096.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 9e-47 48
Cyan7425_3411 YP_002484096.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 9e-47 48
Cyan7425_3411 YP_002484096.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 9e-47 48
Cyan7425_3411 YP_002484096.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 9e-47 48
Cyan7425_3411 YP_002484096.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 9e-47 48
Cyan7425_3411 YP_002484096.1 winged helix family two component transcriptional regulator BAC0083 Protein 6e-40 46
Cyan7425_3411 YP_002484096.1 winged helix family two component transcriptional regulator BAC0308 Protein 7e-40 45
Cyan7425_3411 YP_002484096.1 winged helix family two component transcriptional regulator BAC0197 Protein 4e-37 45
Cyan7425_3411 YP_002484096.1 winged helix family two component transcriptional regulator BAC0638 Protein 3e-33 45
Cyan7425_3411 YP_002484096.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 5e-40 45
Cyan7425_3411 YP_002484096.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 3e-41 44
Cyan7425_3411 YP_002484096.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 3e-41 44
Cyan7425_3411 YP_002484096.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 4e-41 44
Cyan7425_3411 YP_002484096.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 4e-41 44
Cyan7425_3411 YP_002484096.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 4e-41 44
Cyan7425_3411 YP_002484096.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 3e-41 44
Cyan7425_3411 YP_002484096.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 4e-41 44
Cyan7425_3411 YP_002484096.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 4e-41 44
Cyan7425_3411 YP_002484096.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 4e-41 44
Cyan7425_3411 YP_002484096.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 4e-41 44
Cyan7425_3411 YP_002484096.1 winged helix family two component transcriptional regulator BAC0347 Protein 2e-38 44
Cyan7425_3411 YP_002484096.1 winged helix family two component transcriptional regulator BAC0125 Protein 2e-39 44
Cyan7425_3411 YP_002484096.1 winged helix family two component transcriptional regulator BAC0111 Protein 2e-39 44
Cyan7425_3411 YP_002484096.1 winged helix family two component transcriptional regulator CP004022.1.gene3215. Protein 1e-22 41
Cyan7425_3411 YP_002484096.1 winged helix family two component transcriptional regulator BAC0288 Protein 4e-33 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Cyan7425_3411 YP_002484096.1 winged helix family two component transcriptional regulator VFG1390 Protein 5e-56 55
Cyan7425_3411 YP_002484096.1 winged helix family two component transcriptional regulator VFG0596 Protein 2e-36 47
Cyan7425_3411 YP_002484096.1 winged helix family two component transcriptional regulator VFG1386 Protein 4e-46 46
Cyan7425_3411 YP_002484096.1 winged helix family two component transcriptional regulator VFG1389 Protein 2e-41 46