Gene Information

Name : A2cp1_0440 (A2cp1_0440)
Accession : YP_002490863.1
Strain : Anaeromyxobacter dehalogenans 2CP-1
Genome accession: NC_011891
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 498127 - 498819 bp
Length : 693 bp
Strand : +
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: ank:AnaeK_0439 two component transcriptional regulator, winged helix family

DNA sequence :
ATGGCTGAGCGGATCCTGGTGATCGAGGACGACCCCTCCATCCTGCGGGGCCTGCAGCTCAACCTCGGGATGGAGGGCTA
CACCGTCCGGTCCGCGACGGACGGCGAGACCGGGCTGCAGCTGGCGCGCACCGAGCAGCCGGATCTCGTGGTGGTGGACG
TGATGTTGCCACGCATGGGCGGGCTGGAGGTGATCCGCGAGATCCGCAAGGAGGATCCCGAGCTCCCCATCCTCATCCTG
TCGGCGAAGAACCAGGAGACCGACAAGGTGGCCGGGCTGCAGCTCGGCGCCGACGACTACCTGGGCAAGCCGTTCGGGCT
CAAGGAGCTGCTGGCGCGCATCGACGCGCTGCTGCGCCGGCGCCGCGCGCGCGGCGAGGGCGTGCAGCCGAAGGCGATCC
GCAGGGTGGGGGGCATCGAGCTCGATCTGGACGCGCGGCGCGCGCTGGTGGACGGCCGCGCCCTCGAGCTGACCAGCCGC
GAGTTCGACCTGCTCGCGTTCTTCGTCACCCACCCGGACCGCGTCTACTCGCGCGAGCAGCTCATGGAGGCGGTGTGGGG
CTCGCGCTACTTCGGCACGGCCCGCACCGTGGACAACTTCGTGGCCCGGCTCCGCGCCCACATCGGCGACGACGCCGAGC
AGCCGCGCCACCTCGAGACGGTCCGCGGCATCGGCTACAGATTCAATGTTTGA

Protein sequence :
MAERILVIEDDPSILRGLQLNLGMEGYTVRSATDGETGLQLARTEQPDLVVVDVMLPRMGGLEVIREIRKEDPELPILIL
SAKNQETDKVAGLQLGADDYLGKPFGLKELLARIDALLRRRRARGEGVQPKAIRRVGGIELDLDARRALVDGRALELTSR
EFDLLAFFVTHPDRVYSREQLMEAVWGSRYFGTARTVDNFVARLRAHIGDDAEQPRHLETVRGIGYRFNV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 7e-35 43
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 9e-34 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
A2cp1_0440 YP_002490863.1 winged helix family two component transcriptional regulator AE016830.1.gene1681. Protein 2e-42 44
A2cp1_0440 YP_002490863.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 2e-41 43
A2cp1_0440 YP_002490863.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 4e-36 42
A2cp1_0440 YP_002490863.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 4e-29 41
A2cp1_0440 YP_002490863.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 4e-29 41
A2cp1_0440 YP_002490863.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 4e-29 41
A2cp1_0440 YP_002490863.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 4e-29 41
A2cp1_0440 YP_002490863.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 4e-29 41
A2cp1_0440 YP_002490863.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 4e-29 41
A2cp1_0440 YP_002490863.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 4e-29 41
A2cp1_0440 YP_002490863.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 4e-29 41
A2cp1_0440 YP_002490863.1 winged helix family two component transcriptional regulator AE015929.1.gene1106. Protein 5e-25 41
A2cp1_0440 YP_002490863.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 4e-32 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
A2cp1_0440 YP_002490863.1 winged helix family two component transcriptional regulator VFG1563 Protein 4e-35 43
A2cp1_0440 YP_002490863.1 winged helix family two component transcriptional regulator VFG1702 Protein 3e-34 42