Gene Information

Name : Mnod_8375 (Mnod_8375)
Accession : YP_002495000.1
Strain :
Genome accession: NC_011892
Putative virulence/resistance : Unknown
Product : IS66 Orf2 family protein
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG3436
EC number : -
Position : 112815 - 113096 bp
Length : 282 bp
Strand : -
Note : PFAM: IS66 Orf2 family protein; KEGG: mag:amb3326 transposase

DNA sequence :
ATGATCCCGGTCCCCTCGGGCGTCCGGGTCTGGATCGCCAGCGGCCACACCGACATGCGCCGCGGCATGAACGGCCTCTG
CCTGCAGGGGCAGGAGGCGCTCGGGCGCGATCCGCACGCCGGGGATCTCTCCGTGTTCCGCGGCCGGCGCGGTGATCTGA
TCAAATGTCTCTGGCATCACGGTCTCGGGCTATCGCTCTACGCGAAAAGATTGGAGAAGGGCCGCTTTCTCTGGCCCTCA
CGTAAGCGTCGTTTTGGAGGCACCTTTCGGGAGCTCGGCTGA

Protein sequence :
MIPVPSGVRVWIASGHTDMRRGMNGLCLQGQEALGRDPHAGDLSVFRGRRGDLIKCLWHHGLGLSLYAKRLEKGRFLWPS
RKRRFGGTFRELG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
l0014 CAD33776.1 L0014 protein Not tested PAI I 536 Protein 4e-16 55
unnamed AAC31493.1 L0014 Not tested LEE Protein 2e-16 54
c3578 NP_755453.1 hypothetical protein Not tested PAI I CFT073 Protein 3e-16 54
hp4 AAC61716.1 Hp4 Not tested PAI I CFT073 Protein 2e-16 54
Z4336 NP_289561.1 hypothetical protein Not tested OI-122 Protein 3e-16 54
unnamed AAL99258.1 unknown Not tested LEE Protein 2e-16 54
Z5097 NP_290248.1 prophage-associated protein Not tested LEE Protein 3e-16 54
unnamed ACU09438.1 IS66 family element orf2 Not tested LEE Protein 2e-16 54
ECs4546 NP_312573.1 hypothetical protein Not tested LEE Protein 3e-16 54
aec52 AAW51735.1 Aec52 Not tested AGI-3 Protein 2e-18 54
unnamed ADD91739.1 hypothetical protein Not tested PAI-I AL862 Protein 2e-18 54
unnamed AAL08461.1 unknown Not tested SRL Protein 4e-16 53
ECUMN_3327 YP_002414007.1 putative transposase ORF2, IS66 family Not tested Not named Protein 3e-16 53
pB171ORF50 CAD66190.1 ORF50 protein of pB171 Not tested PAI III 536 Protein 4e-18 53
Z1132 NP_286667.1 hypothetical protein Not tested TAI Protein 1e-15 53
Z1571 NP_287075.1 hypothetical protein Not tested TAI Protein 1e-15 53
c3561 NP_755436.1 hypothetical protein Not tested PAI I CFT073 Protein 3e-16 53
ECO103_3553 YP_003223420.1 hypothetical protein Not tested LEE Protein 1e-16 52
Z4316 NP_289542.1 hypothetical protein Not tested OI-122 Protein 1e-16 52

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Mnod_8375 YP_002495000.1 IS66 Orf2 family protein VFG1517 Protein 1e-16 55
Mnod_8375 YP_002495000.1 IS66 Orf2 family protein VFG1709 Protein 9e-17 54
Mnod_8375 YP_002495000.1 IS66 Orf2 family protein VFG0792 Protein 9e-17 54
Mnod_8375 YP_002495000.1 IS66 Orf2 family protein VFG1698 Protein 9e-17 53
Mnod_8375 YP_002495000.1 IS66 Orf2 family protein VFG1052 Protein 1e-16 53
Mnod_8375 YP_002495000.1 IS66 Orf2 family protein VFG1665 Protein 2e-18 53