Gene Information

Name : Mnod_7423 (Mnod_7423)
Accession : YP_002502463.1
Strain : Methylobacterium nodulans ORS 2060
Genome accession: NC_011894
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator PhoB
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 7511116 - 7511820 bp
Length : 705 bp
Strand : -
Note : TIGRFAM: phosphate regulon transcriptional regulatory protein PhoB; PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: met:M446_6685 two component transcriptional regulator

DNA sequence :
ATGAGTACGAGGATCCTGATCGTCGAGGACGAGGAGCCGCTGACGCTCCTCCTTCGCTACAACCTCGAGGCCGAGGGCTT
CGAGGTCGATGCCGTCGCCCGCGGCGACGAGGCCGATATCCGGCTGCGCGAGCAGATCCCGGATCTCGTCCTCCTCGACT
GGATGGTGCCGGGCCTGTCCGGGATCGAACTCTGCCGCCGCATCCGGGCGCGCCGGGAGACGGAGCGGCTGCCGATCATC
ATGCTGACCGCGCGGGGCGAGGAGGGCGACCGGGTGCGCGGGCTCGCGACGGGAGCCGACGATTACATCGTCAAGCCCTT
CTCGGTGCCGGAACTGCTGGCGCGGGTGCGGGCGCTCCTGCGCCGCGCGAAGCCGGCCCACGTGGCGCACCTCCTGGTCG
CGGGCGATATCGAGCTCGACCGGGTGAGCCATCGCGTCAGGCGCGAGGGCCGCGAGCTCCATCTCGGCCCGACGGAGTTC
AAGCTGCTCGAGTTCCTGATGCAGAGCCCCGGCCGGGTCTTCTCCCGGGAGCAGCTCCTCGATGGCGTCTGGGGCCACGA
CGTCTATATCGACGAGCGCACCGTCGACGTGCATATCGGCCGCTTGCGCAAGGCCATCAACCGGCCGCGCCGTCCCGACC
CGATCCGCACCGTGAGGGGATCGGGCTATTCGTTCGACGAGATGTTCGCCAACGGCACGGCCTGA

Protein sequence :
MSTRILIVEDEEPLTLLLRYNLEAEGFEVDAVARGDEADIRLREQIPDLVLLDWMVPGLSGIELCRRIRARRETERLPII
MLTARGEEGDRVRGLATGADDYIVKPFSVPELLARVRALLRRAKPAHVAHLLVAGDIELDRVSHRVRREGRELHLGPTEF
KLLEFLMQSPGRVFSREQLLDGVWGHDVYIDERTVDVHIGRLRKAINRPRRPDPIRTVRGSGYSFDEMFANGTA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 1e-25 43
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 1e-25 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Mnod_7423 YP_002502463.1 winged helix family two component transcriptional regulator PhoB NC_012469.1.7686381. Protein 5e-28 43
Mnod_7423 YP_002502463.1 winged helix family two component transcriptional regulator PhoB NC_012469.1.7685629. Protein 5e-28 43
Mnod_7423 YP_002502463.1 winged helix family two component transcriptional regulator PhoB AE000516.2.gene3505. Protein 4e-34 43
Mnod_7423 YP_002502463.1 winged helix family two component transcriptional regulator PhoB NC_010410.6002989.p0 Protein 1e-26 42
Mnod_7423 YP_002502463.1 winged helix family two component transcriptional regulator PhoB NC_011595.7057856.p0 Protein 1e-26 42
Mnod_7423 YP_002502463.1 winged helix family two component transcriptional regulator PhoB HE999704.1.gene1528. Protein 2e-22 42
Mnod_7423 YP_002502463.1 winged helix family two component transcriptional regulator PhoB CP001138.1.gene2239. Protein 1e-23 42
Mnod_7423 YP_002502463.1 winged helix family two component transcriptional regulator PhoB CP000647.1.gene2531. Protein 6e-24 42
Mnod_7423 YP_002502463.1 winged helix family two component transcriptional regulator PhoB BAC0039 Protein 3e-24 42
Mnod_7423 YP_002502463.1 winged helix family two component transcriptional regulator PhoB CP001918.1.gene3444. Protein 2e-24 42
Mnod_7423 YP_002502463.1 winged helix family two component transcriptional regulator PhoB BAC0596 Protein 1e-23 42
Mnod_7423 YP_002502463.1 winged helix family two component transcriptional regulator PhoB CP000034.1.gene2186. Protein 3e-24 42
Mnod_7423 YP_002502463.1 winged helix family two component transcriptional regulator PhoB NC_002695.1.916589.p Protein 2e-24 42
Mnod_7423 YP_002502463.1 winged helix family two component transcriptional regulator PhoB CP000675.2.gene1535. Protein 4e-26 41
Mnod_7423 YP_002502463.1 winged helix family two component transcriptional regulator PhoB NC_003923.1003749.p0 Protein 2e-31 41
Mnod_7423 YP_002502463.1 winged helix family two component transcriptional regulator PhoB NC_010400.5986590.p0 Protein 5e-26 41
Mnod_7423 YP_002502463.1 winged helix family two component transcriptional regulator PhoB HE999704.1.gene2815. Protein 2e-29 41
Mnod_7423 YP_002502463.1 winged helix family two component transcriptional regulator PhoB CP001485.1.gene721.p Protein 1e-21 41
Mnod_7423 YP_002502463.1 winged helix family two component transcriptional regulator PhoB BAC0197 Protein 4e-20 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Mnod_7423 YP_002502463.1 winged helix family two component transcriptional regulator PhoB VFG1390 Protein 7e-25 43
Mnod_7423 YP_002502463.1 winged helix family two component transcriptional regulator PhoB VFG1563 Protein 6e-26 43
Mnod_7423 YP_002502463.1 winged helix family two component transcriptional regulator PhoB VFG1702 Protein 5e-26 43