Gene Information

Name : MLBr_02123 (MLBr_02123)
Accession : YP_002504032.1
Strain : Mycobacterium leprae Br4923
Genome accession: NC_011896
Putative virulence/resistance : Virulence
Product : two-component response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2524075 - 2524776 bp
Length : 702 bp
Strand : +
Note : -

DNA sequence :
ATGGACACTGGTGTAAGCTCACCTCGAGTGTTGGTCGTCGACGACGATTCCGATGTGCTTGCCTCGCTGGAGCGAGGCCT
ACGGCTATCCGGATTCGAGGTATCGACTGCTATCGACGGTGCCGAGGCGTTGCGCAACGCCACCGAGACCCGGCCGGATG
CAATCGTGCTCGACATCAATATGCCGGTACTGGACGGTGTAAGCGTCGTCACGGCATTAAGAGCCATGGACAACGACGTC
CCAGTCTGCGTGCTGTCCGCACGCAGTTCGGTCGACGATCGAGTGGCGGGCCTGGAGGCCGGCGCCGATGATTACCTGGT
CAAACCGTTCGTGCTGGCCGAGCTGGTGGCACGAGTGAAAGCGCTGCTGCGCCGCCGCGGCGCTACCGCAACGTCTTCCT
CGGAAACCATAGCCGTGGGCCCGCTGGAGGTAGACATCCCCGGTCGGCGGGCCCGAGTCAATGGCGTCGATGTCGACCTG
ACCAAGCGAGAGTTCGATCTGCTGGCAGTGCTGGCTGAGCACAAGACCACCGTCTTGTCACGCGCCCAGCTGCTGGAGCT
GGTGTGGGGCTATGATTTCGCCGCCGACACGAATGTCGTCGACGTGTTCATCGGGTACCTGCGCCGCAAGTTGGAGGCCA
ACAGCGGGCCCAGGCTACTGCACACCGTTCGAGGAGTTGGGTTCGTACTGCGCATGCAGTAA

Protein sequence :
MDTGVSSPRVLVVDDDSDVLASLERGLRLSGFEVSTAIDGAEALRNATETRPDAIVLDINMPVLDGVSVVTALRAMDNDV
PVCVLSARSSVDDRVAGLEAGADDYLVKPFVLAELVARVKALLRRRGATATSSSETIAVGPLEVDIPGRRARVNGVDVDL
TKREFDLLAVLAEHKTTVLSRAQLLELVWGYDFAADTNVVDVFIGYLRRKLEANSGPRLLHTVRGVGFVLRMQ

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 4e-25 42
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 2e-24 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
MLBr_02123 YP_002504032.1 two-component response regulator BAC0083 Protein 9e-31 45
MLBr_02123 YP_002504032.1 two-component response regulator BAC0125 Protein 5e-30 44
MLBr_02123 YP_002504032.1 two-component response regulator BAC0197 Protein 1e-24 44
MLBr_02123 YP_002504032.1 two-component response regulator AE000516.2.gene3505. Protein 7e-29 44
MLBr_02123 YP_002504032.1 two-component response regulator BAC0638 Protein 4e-24 43
MLBr_02123 YP_002504032.1 two-component response regulator NC_012469.1.7685629. Protein 2e-27 43
MLBr_02123 YP_002504032.1 two-component response regulator HE999704.1.gene1528. Protein 1e-30 42
MLBr_02123 YP_002504032.1 two-component response regulator NC_012469.1.7686381. Protein 9e-23 42
MLBr_02123 YP_002504032.1 two-component response regulator NC_002952.2859905.p0 Protein 2e-27 42
MLBr_02123 YP_002504032.1 two-component response regulator NC_007793.3914279.p0 Protein 3e-27 42
MLBr_02123 YP_002504032.1 two-component response regulator NC_002745.1124361.p0 Protein 3e-27 42
MLBr_02123 YP_002504032.1 two-component response regulator NC_009782.5559369.p0 Protein 3e-27 42
MLBr_02123 YP_002504032.1 two-component response regulator NC_002951.3237708.p0 Protein 3e-27 42
MLBr_02123 YP_002504032.1 two-component response regulator NC_003923.1003749.p0 Protein 3e-27 42
MLBr_02123 YP_002504032.1 two-component response regulator NC_002758.1121668.p0 Protein 3e-27 42
MLBr_02123 YP_002504032.1 two-component response regulator NC_007622.3794472.p0 Protein 2e-27 42
MLBr_02123 YP_002504032.1 two-component response regulator NC_009641.5332272.p0 Protein 3e-27 42
MLBr_02123 YP_002504032.1 two-component response regulator NC_013450.8614421.p0 Protein 3e-27 42
MLBr_02123 YP_002504032.1 two-component response regulator HE999704.1.gene2815. Protein 1e-26 42
MLBr_02123 YP_002504032.1 two-component response regulator BAC0308 Protein 2e-27 41
MLBr_02123 YP_002504032.1 two-component response regulator BAC0347 Protein 9e-24 41
MLBr_02123 YP_002504032.1 two-component response regulator BAC0111 Protein 8e-26 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
MLBr_02123 YP_002504032.1 two-component response regulator VFG1389 Protein 3e-81 96
MLBr_02123 YP_002504032.1 two-component response regulator VFG1390 Protein 1e-40 50
MLBr_02123 YP_002504032.1 two-component response regulator VFG1386 Protein 1e-35 46
MLBr_02123 YP_002504032.1 two-component response regulator VFG0596 Protein 2e-25 42