Gene Information

Name : Hore_04710 (Hore_04710)
Accession : YP_002508224.1
Strain : Halothermothrix orenii H 168
Genome accession: NC_011899
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 505224 - 505937 bp
Length : 714 bp
Strand : +
Note : PFAM: Transcriptional regulatory protein, C terminal; Response regulator receiver domain

DNA sequence :
ATGGCTGATGGGAGTAGAATACTGGTAGTTGATGATGAACAGGAAATAAGGGAATTACTAAAAAGTTATCTGGAGAGGGA
AGGTTATGTTGTCGATACTGTTAAAGATGGGAAAACAGCCCTTTTCCGTGTATCAAACCAGGACTATAACCTGGTTATTC
TGGATATAATGCTACCCGATACAGATGGGGTTGAGGTTTGTCGCACTATCAGGGAGATAACCAATATTCCCATTATTATG
CTTACTGCCCGGGATAGTGAAGTAGATAAAGTACTGGGATTGAGGATAGGAGCCGATGATTATATTACAAAACCCTTTCT
ACCCGGTGAACTGATAGCCCGGGTTAAAGCTCAGTTGCGACGATTTTTTGTTCTCGGTAGTGAGGGTGATGCCCGGTCCC
GGAAGATGGTTAAGTTTGGTGACCTGAAGATAGATTTTGATGGATACCGGGTTTATAAAAGGAATAAAGAGGTACAGTTG
ACCTCAACTGAATTTAAAATACTTTTACTCCTGGCCCGGGAACCCGGGAAGGTTTTTACCAAGAAGCAGATTTTTAATAA
GGTGTGGGGGGATGATTACCTGGAGGCCGATAACAACGTCATGGTACATATAAGAAGATTGAGAACTAAAATAGAAGATG
ATCCCAAAAATCCTGAATTTATCGAGACTGTCTGGGGGATTGGTTACAGGTTTGCCGGTGATGAAAATGACTGA

Protein sequence :
MADGSRILVVDDEQEIRELLKSYLEREGYVVDTVKDGKTALFRVSNQDYNLVILDIMLPDTDGVEVCRTIREITNIPIIM
LTARDSEVDKVLGLRIGADDYITKPFLPGELIARVKAQLRRFFVLGSEGDARSRKMVKFGDLKIDFDGYRVYKRNKEVQL
TSTEFKILLLLAREPGKVFTKKQIFNKVWGDDYLEADNNVMVHIRRLRTKIEDDPKNPEFIETVWGIGYRFAGDEND

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 5e-41 42
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 6e-41 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Hore_04710 YP_002508224.1 winged helix family two component transcriptional regulator AF155139.2.orf0.gene Protein 2e-52 52
Hore_04710 YP_002508224.1 winged helix family two component transcriptional regulator FJ349556.1.orf0.gene Protein 6e-50 49
Hore_04710 YP_002508224.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 2e-44 47
Hore_04710 YP_002508224.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 2e-44 47
Hore_04710 YP_002508224.1 winged helix family two component transcriptional regulator AM180355.1.gene1830. Protein 3e-47 47
Hore_04710 YP_002508224.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 3e-42 47
Hore_04710 YP_002508224.1 winged helix family two component transcriptional regulator NC_014475.1.orf0.gen Protein 5e-48 46
Hore_04710 YP_002508224.1 winged helix family two component transcriptional regulator NC_005054.2598277.p0 Protein 5e-48 46
Hore_04710 YP_002508224.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 3e-44 46
Hore_04710 YP_002508224.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 3e-44 46
Hore_04710 YP_002508224.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 3e-44 46
Hore_04710 YP_002508224.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 3e-44 46
Hore_04710 YP_002508224.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 3e-44 46
Hore_04710 YP_002508224.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 3e-44 46
Hore_04710 YP_002508224.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 2e-44 46
Hore_04710 YP_002508224.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 3e-44 46
Hore_04710 YP_002508224.1 winged helix family two component transcriptional regulator DQ212986.1.gene4.p01 Protein 4e-45 45
Hore_04710 YP_002508224.1 winged helix family two component transcriptional regulator EU250284.1.orf4.gene Protein 3e-44 44
Hore_04710 YP_002508224.1 winged helix family two component transcriptional regulator AF130997.1.orf0.gene Protein 5e-43 44
Hore_04710 YP_002508224.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 1e-41 44
Hore_04710 YP_002508224.1 winged helix family two component transcriptional regulator AF162694.1.orf4.gene Protein 2e-43 43
Hore_04710 YP_002508224.1 winged helix family two component transcriptional regulator NC_012469.1.7686381. Protein 4e-43 43
Hore_04710 YP_002508224.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 1e-38 43
Hore_04710 YP_002508224.1 winged helix family two component transcriptional regulator AE016830.1.gene1681. Protein 9e-42 42
Hore_04710 YP_002508224.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 4e-33 41
Hore_04710 YP_002508224.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 4e-33 41
Hore_04710 YP_002508224.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 4e-33 41
Hore_04710 YP_002508224.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 4e-33 41
Hore_04710 YP_002508224.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 4e-33 41
Hore_04710 YP_002508224.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 4e-33 41
Hore_04710 YP_002508224.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 4e-33 41
Hore_04710 YP_002508224.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 4e-33 41
Hore_04710 YP_002508224.1 winged helix family two component transcriptional regulator BAC0197 Protein 3e-33 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Hore_04710 YP_002508224.1 winged helix family two component transcriptional regulator VFG1563 Protein 3e-41 42
Hore_04710 YP_002508224.1 winged helix family two component transcriptional regulator VFG1702 Protein 3e-41 41
Hore_04710 YP_002508224.1 winged helix family two component transcriptional regulator VFG1390 Protein 1e-34 41