Gene Information

Name : Tgr7_1208 (Tgr7_1208)
Accession : YP_002513281.1
Strain : Thioalkalivibrio sulfidophilus HL-EbGR7
Genome accession: NC_011901
Putative virulence/resistance : Virulence
Product : two component heavy metal response transcriptional regulator, winged helix family
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1299985 - 1300665 bp
Length : 681 bp
Strand : +
Note : TIGRFAM: heavy metal response regulator; PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: azo:azo2946 two component response regulator

DNA sequence :
GTGAAGATTCTCATCGTGGAGGACGAACCCAAGACCGGCGAATACCTGCGCCAGGGTCTGAGCGAGGCGGGGTTTGTGGT
GGATCTTGCCCGGGATGGCCTGGACGGCCTGCACCTGGCCACCACCGGGGACTACGACCTGCTGATCCTGGACGTGATGC
TGCCGCGCATGGATGGCTGGGCCCTGCTGCAGGCGGTGCGCCTGTCGGGCCGGGAGATGCCGGTGCTGTTCCTCACCGCC
CGGGACGCGGTGGAGGACCGGGTGCGTGGCCTGGAGTTGGGGGCCGACGACTACCTGGTCAAACCCTTCGCCTTCTCGGA
ACTGCTGGCCCGGGTGCGCAGCCTGCTGCGCCGGGGCAAGAGCAAGGAACCGGAGACCCTCAAGGCCGCCGATCTGGAGA
TCGACCTGCTGCGCCGCCGGGTCACCCGGGGCGGCACACGCATCGATCTGACCGCCAAGGAGTTCGCTCTGCTGGAACTG
CTGGTGCGTCGCCAGGGGGAGGTGCTGCCCCGCTCGCTGATCGCCTCCCAGGTATGGGACATGAACTTCGACAGCGACAC
CAACGTGATCGAGGTGGCGGTGCGTCGCCTGCGCGCCAAGGTGGATGAGCCCTTCGAGCCCAAGCTGATCCGAACGGTGC
GCGGCATGGGCTACGTGCTCGAGGCGCCGGAGGCACCGTGA

Protein sequence :
MKILIVEDEPKTGEYLRQGLSEAGFVVDLARDGLDGLHLATTGDYDLLILDVMLPRMDGWALLQAVRLSGREMPVLFLTA
RDAVEDRVRGLELGADDYLVKPFAFSELLARVRSLLRRGKSKEPETLKAADLEIDLLRRRVTRGGTRIDLTAKEFALLEL
LVRRQGEVLPRSLIASQVWDMNFDSDTNVIEVAVRRLRAKVDEPFEPKLIRTVRGMGYVLEAPEAP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-57 59
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 7e-57 59

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Tgr7_1208 YP_002513281.1 two component heavy metal response transcriptional regulator, winged helix family BAC0638 Protein 2e-62 72
Tgr7_1208 YP_002513281.1 two component heavy metal response transcriptional regulator, winged helix family BAC0083 Protein 1e-66 70
Tgr7_1208 YP_002513281.1 two component heavy metal response transcriptional regulator, winged helix family BAC0111 Protein 3e-69 68
Tgr7_1208 YP_002513281.1 two component heavy metal response transcriptional regulator, winged helix family BAC0125 Protein 8e-69 68
Tgr7_1208 YP_002513281.1 two component heavy metal response transcriptional regulator, winged helix family BAC0197 Protein 1e-68 67
Tgr7_1208 YP_002513281.1 two component heavy metal response transcriptional regulator, winged helix family BAC0308 Protein 2e-65 65
Tgr7_1208 YP_002513281.1 two component heavy metal response transcriptional regulator, winged helix family BAC0347 Protein 4e-63 64
Tgr7_1208 YP_002513281.1 two component heavy metal response transcriptional regulator, winged helix family HE999704.1.gene1528. Protein 1e-27 43
Tgr7_1208 YP_002513281.1 two component heavy metal response transcriptional regulator, winged helix family BAC0487 Protein 2e-29 42
Tgr7_1208 YP_002513281.1 two component heavy metal response transcriptional regulator, winged helix family NC_007793.3914065.p0 Protein 1e-34 42
Tgr7_1208 YP_002513281.1 two component heavy metal response transcriptional regulator, winged helix family NC_002758.1121390.p0 Protein 1e-34 42
Tgr7_1208 YP_002513281.1 two component heavy metal response transcriptional regulator, winged helix family NC_010079.5776364.p0 Protein 1e-34 42
Tgr7_1208 YP_002513281.1 two component heavy metal response transcriptional regulator, winged helix family NC_002952.2859858.p0 Protein 1e-34 42
Tgr7_1208 YP_002513281.1 two component heavy metal response transcriptional regulator, winged helix family NC_007622.3794948.p0 Protein 1e-34 42
Tgr7_1208 YP_002513281.1 two component heavy metal response transcriptional regulator, winged helix family NC_003923.1003417.p0 Protein 1e-34 42
Tgr7_1208 YP_002513281.1 two component heavy metal response transcriptional regulator, winged helix family NC_013450.8614146.p0 Protein 1e-34 42
Tgr7_1208 YP_002513281.1 two component heavy metal response transcriptional regulator, winged helix family NC_002951.3238224.p0 Protein 1e-34 42
Tgr7_1208 YP_002513281.1 two component heavy metal response transcriptional regulator, winged helix family AE000516.2.gene3505. Protein 1e-24 42
Tgr7_1208 YP_002513281.1 two component heavy metal response transcriptional regulator, winged helix family NC_002951.3237708.p0 Protein 5e-34 41
Tgr7_1208 YP_002513281.1 two component heavy metal response transcriptional regulator, winged helix family NC_002758.1121668.p0 Protein 5e-34 41
Tgr7_1208 YP_002513281.1 two component heavy metal response transcriptional regulator, winged helix family NC_009641.5332272.p0 Protein 5e-34 41
Tgr7_1208 YP_002513281.1 two component heavy metal response transcriptional regulator, winged helix family NC_013450.8614421.p0 Protein 5e-34 41
Tgr7_1208 YP_002513281.1 two component heavy metal response transcriptional regulator, winged helix family NC_007793.3914279.p0 Protein 5e-34 41
Tgr7_1208 YP_002513281.1 two component heavy metal response transcriptional regulator, winged helix family NC_007622.3794472.p0 Protein 7e-34 41
Tgr7_1208 YP_002513281.1 two component heavy metal response transcriptional regulator, winged helix family NC_002745.1124361.p0 Protein 5e-34 41
Tgr7_1208 YP_002513281.1 two component heavy metal response transcriptional regulator, winged helix family NC_009782.5559369.p0 Protein 5e-34 41
Tgr7_1208 YP_002513281.1 two component heavy metal response transcriptional regulator, winged helix family NC_002952.2859905.p0 Protein 8e-34 41
Tgr7_1208 YP_002513281.1 two component heavy metal response transcriptional regulator, winged helix family NC_002516.2.879194.p Protein 6e-28 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Tgr7_1208 YP_002513281.1 two component heavy metal response transcriptional regulator, winged helix family VFG0596 Protein 5e-58 59
Tgr7_1208 YP_002513281.1 two component heavy metal response transcriptional regulator, winged helix family VFG1390 Protein 1e-42 48
Tgr7_1208 YP_002513281.1 two component heavy metal response transcriptional regulator, winged helix family VFG1389 Protein 6e-34 44
Tgr7_1208 YP_002513281.1 two component heavy metal response transcriptional regulator, winged helix family VFG1386 Protein 4e-34 43