Gene Information

Name : CCNA_01351 (CCNA_01351)
Accession : YP_002516724.1
Strain : Caulobacter crescentus NA1000
Genome accession: NC_011916
Putative virulence/resistance : Virulence
Product : two-component response regulator protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1463228 - 1463956 bp
Length : 729 bp
Strand : -
Note : CC_1293

DNA sequence :
ATGCACATACTGGTGGTGGAGGACGATACGCGCGTCGCAGACTTCCTTGAGCGCGGCTTGAAGGCCGAAGGGTACAAGGT
CCGCGTGGCGCGAGACGGTGTGAGCGGCCTGGAGGCGGCCCGCGACCTGGACGCCATGCTGCGTGAGCTGGATCAGCGCG
GCGTGATCCTCTTGGACCTGATGCTTCCGAAGATGACCGGCATGGAAGTCTGCCAGACCCTTCGGGCGTCCGGTGTCTTG
ACGCCAGTCCTGATGCTGACCGCCCTGGGGGCCGTTGATGACCGCGTCACGGGCCTGAGAACGGGCGCTGACGACTACCT
GGTCAAGCCGTTCTCCTTCGAGGAGCTCCTTGCCCGGATCGAAGCGCTGCTTCGTCGATCGCGGGATCAGCGGGCGCCCG
CCAATCGGACGCTGAAGGCCGGAAACGTCGAACTGGACCGGACGACCATGCGCGTCTCCCGCGACGGCGAGGAAGTGGTC
CTGACCGCCCGCGAGCTTGCGCTCCTGGAGCTGTTCCTGTCCTCGCCAGGACGGGTTCTGAGCCGCGAACGCATCCTCTC
CAACGTCTGGGGCGTGGACGAGGACCCCCTGACGAACGTGGTCGATGTCTATGTCCGTCGACTGAGGGCCAAGATCGATC
CCCCTCTCGCGTCGTCCTTTATCACCACGGTGAGGGGCCTGGGATATCGGCTCGAGCCCGATCCCGCGAAAGTCCCGATC
GGTGCCTAG

Protein sequence :
MHILVVEDDTRVADFLERGLKAEGYKVRVARDGVSGLEAARDLDAMLRELDQRGVILLDLMLPKMTGMEVCQTLRASGVL
TPVLMLTALGAVDDRVTGLRTGADDYLVKPFSFEELLARIEALLRRSRDQRAPANRTLKAGNVELDRTTMRVSRDGEEVV
LTARELALLELFLSSPGRVLSRERILSNVWGVDEDPLTNVVDVYVRRLRAKIDPPLASSFITTVRGLGYRLEPDPAKVPI
GA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 4e-33 44
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 3e-32 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
CCNA_01351 YP_002516724.1 two-component response regulator protein HE999704.1.gene1528. Protein 9e-35 47
CCNA_01351 YP_002516724.1 two-component response regulator protein BAC0125 Protein 2e-37 46
CCNA_01351 YP_002516724.1 two-component response regulator protein BAC0308 Protein 6e-31 46
CCNA_01351 YP_002516724.1 two-component response regulator protein BAC0638 Protein 6e-27 45
CCNA_01351 YP_002516724.1 two-component response regulator protein BAC0197 Protein 2e-32 44
CCNA_01351 YP_002516724.1 two-component response regulator protein NC_002952.2859858.p0 Protein 2e-32 42
CCNA_01351 YP_002516724.1 two-component response regulator protein NC_007622.3794948.p0 Protein 2e-32 42
CCNA_01351 YP_002516724.1 two-component response regulator protein NC_003923.1003417.p0 Protein 2e-32 42
CCNA_01351 YP_002516724.1 two-component response regulator protein NC_013450.8614146.p0 Protein 2e-32 42
CCNA_01351 YP_002516724.1 two-component response regulator protein NC_002951.3238224.p0 Protein 2e-32 42
CCNA_01351 YP_002516724.1 two-component response regulator protein NC_007793.3914065.p0 Protein 2e-32 42
CCNA_01351 YP_002516724.1 two-component response regulator protein NC_002758.1121390.p0 Protein 2e-32 42
CCNA_01351 YP_002516724.1 two-component response regulator protein NC_010079.5776364.p0 Protein 2e-32 42
CCNA_01351 YP_002516724.1 two-component response regulator protein BAC0083 Protein 1e-31 42
CCNA_01351 YP_002516724.1 two-component response regulator protein BAC0111 Protein 2e-35 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
CCNA_01351 YP_002516724.1 two-component response regulator protein VFG0596 Protein 2e-33 44
CCNA_01351 YP_002516724.1 two-component response regulator protein VFG1390 Protein 4e-35 44
CCNA_01351 YP_002516724.1 two-component response regulator protein VFG1389 Protein 2e-24 41