Gene Information

Name : phoB (CCNA_00296)
Accession : YP_002515671.1
Strain : Caulobacter crescentus NA1000
Genome accession: NC_011916
Putative virulence/resistance : Virulence
Product : phosphate regulon response regulator PhoB
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 310374 - 311066 bp
Length : 693 bp
Strand : +
Note : CC_0294

DNA sequence :
GTGACTCCCTACGTTTTGGTGGTCGAAGACGAAGACGCTCTGGCCACTCTGCTCCACTACAACCTCGACAAGGAGGGCTA
CCGCGTCGGCGTCGCCGGCGACGGTGAGGAAGCCCTGATCATGGCCAATGAGCGGGCCCCGGACCTGGTCATCCTCGACT
GGATGCTGCCCAAGGTCTCGGGCATCGAGGTCTGCCGCCGCCTGCGCGGCCGCGCCGAGACGCGCAATGTGCCGATCATC
ATGCTGACGGCCCGCGGCGAGGAAACTGATCGCATCCGCGGTCTCGACACCGGCGCCGACGACTATGTGGTCAAGCCGTT
CTCGATGGTCGAGCTGACCGCCCGGGTCCGCGCCGTGCTGCGCCGCATCCGCCCGGGTCTGGCCGATGACCGCATCACCG
TCGGCGACATCATCATCGACCGCGTCGCCCACAGGGTGAAGCGCAGCGGCAAGGAGATCCACCTTGGCCCGACCGAGTTC
CGTCTGCTCGACTACCTGATGCAGCACCCGGGCCGGGTGTTCAGCCGCGAGCAGCTGCTGGACGCGGTCTGGGGGTCGGA
CGTCTATGTCGAGGCCCGCACGGTCGACGTTCACATCGGCCGTCTTCGCAAGGCGCTGAACGGGACGACGGACGCCGATC
CCATCCGCACCGTGCGTTCGGCGGGCTACTCGCTGGACATGGATGCGGCCTGA

Protein sequence :
MTPYVLVVEDEDALATLLHYNLDKEGYRVGVAGDGEEALIMANERAPDLVILDWMLPKVSGIEVCRRLRGRAETRNVPII
MLTARGEETDRIRGLDTGADDYVVKPFSMVELTARVRAVLRRIRPGLADDRITVGDIIIDRVAHRVKRSGKEIHLGPTEF
RLLDYLMQHPGRVFSREQLLDAVWGSDVYVEARTVDVHIGRLRKALNGTTDADPIRTVRSAGYSLDMDAA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 5e-36 42
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 3e-35 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
phoB YP_002515671.1 phosphate regulon response regulator PhoB NC_002952.2859905.p0 Protein 2e-44 47
phoB YP_002515671.1 phosphate regulon response regulator PhoB NC_009782.5559369.p0 Protein 2e-44 47
phoB YP_002515671.1 phosphate regulon response regulator PhoB NC_002951.3237708.p0 Protein 2e-44 47
phoB YP_002515671.1 phosphate regulon response regulator PhoB NC_003923.1003749.p0 Protein 2e-44 47
phoB YP_002515671.1 phosphate regulon response regulator PhoB NC_002758.1121668.p0 Protein 2e-44 47
phoB YP_002515671.1 phosphate regulon response regulator PhoB NC_007622.3794472.p0 Protein 2e-44 47
phoB YP_002515671.1 phosphate regulon response regulator PhoB NC_009641.5332272.p0 Protein 2e-44 47
phoB YP_002515671.1 phosphate regulon response regulator PhoB NC_013450.8614421.p0 Protein 2e-44 47
phoB YP_002515671.1 phosphate regulon response regulator PhoB NC_007793.3914279.p0 Protein 2e-44 47
phoB YP_002515671.1 phosphate regulon response regulator PhoB NC_002745.1124361.p0 Protein 2e-44 47
phoB YP_002515671.1 phosphate regulon response regulator PhoB HE999704.1.gene2815. Protein 1e-41 45
phoB YP_002515671.1 phosphate regulon response regulator PhoB AE000516.2.gene3505. Protein 8e-37 45
phoB YP_002515671.1 phosphate regulon response regulator PhoB NC_007622.3794948.p0 Protein 4e-39 44
phoB YP_002515671.1 phosphate regulon response regulator PhoB NC_003923.1003417.p0 Protein 4e-39 44
phoB YP_002515671.1 phosphate regulon response regulator PhoB NC_013450.8614146.p0 Protein 4e-39 44
phoB YP_002515671.1 phosphate regulon response regulator PhoB NC_002951.3238224.p0 Protein 4e-39 44
phoB YP_002515671.1 phosphate regulon response regulator PhoB NC_007793.3914065.p0 Protein 4e-39 44
phoB YP_002515671.1 phosphate regulon response regulator PhoB NC_002758.1121390.p0 Protein 4e-39 44
phoB YP_002515671.1 phosphate regulon response regulator PhoB NC_010079.5776364.p0 Protein 4e-39 44
phoB YP_002515671.1 phosphate regulon response regulator PhoB NC_002952.2859858.p0 Protein 4e-39 44
phoB YP_002515671.1 phosphate regulon response regulator PhoB AE015929.1.gene1106. Protein 5e-36 43
phoB YP_002515671.1 phosphate regulon response regulator PhoB NC_012469.1.7686381. Protein 4e-41 43
phoB YP_002515671.1 phosphate regulon response regulator PhoB NC_012469.1.7685629. Protein 2e-38 43
phoB YP_002515671.1 phosphate regulon response regulator PhoB BAC0125 Protein 5e-34 42
phoB YP_002515671.1 phosphate regulon response regulator PhoB NC_010410.6002989.p0 Protein 4e-37 41
phoB YP_002515671.1 phosphate regulon response regulator PhoB NC_010400.5986590.p0 Protein 6e-37 41
phoB YP_002515671.1 phosphate regulon response regulator PhoB NC_011595.7057856.p0 Protein 4e-37 41
phoB YP_002515671.1 phosphate regulon response regulator PhoB HE999704.1.gene1528. Protein 2e-32 41
phoB YP_002515671.1 phosphate regulon response regulator PhoB FJ349556.1.orf0.gene Protein 1e-35 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
phoB YP_002515671.1 phosphate regulon response regulator PhoB VFG1390 Protein 3e-40 42
phoB YP_002515671.1 phosphate regulon response regulator PhoB VFG1702 Protein 2e-36 42
phoB YP_002515671.1 phosphate regulon response regulator PhoB VFG1563 Protein 2e-35 41
phoB YP_002515671.1 phosphate regulon response regulator PhoB VFG1386 Protein 8e-32 41
phoB YP_002515671.1 phosphate regulon response regulator PhoB VFG1389 Protein 5e-33 41