Gene Information

Name : trd_A0608 (trd_A0608)
Accession : YP_002523890.1
Strain :
Genome accession: NC_011961
Putative virulence/resistance : Virulence
Product : response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 599625 - 600302 bp
Length : 678 bp
Strand : -
Note : identified by match to protein family HMM PF00072; match to protein family HMM PF00486

DNA sequence :
ATGACGCACGTGCTGGTGGTGGATGACGACACGCGACTAGTGGAGATGCTGCGGCGAACGCTGTCGTACGAGGGTTTCAC
GGTGAGCGTTGCGCAGTCGGGCGATGAGGCGTTGCGCCTGGTGGCGGAGCGGCGACCGGATCTGATCGTGCTCGACTGGT
TATTGCCGGGAATGGACGGGTTGGCGGTAGTCCAGCGCTTGCGAGCGGCTGGTGATGGCACGCCGATCCTGATGCTGACG
GCGCGGGACGCGGTGGAAGACCGCGTTCTGGGGTTGGACAGCGGAGCCGACGACTATCTGGTCAAGCCGTTCGCACCAGC
TGAGCTTCTCGCGCGCATTCGGGCTCTTCTGCGTCGAGTCGAACCGGCTAGCGACGAGAAGCCCCTCGTCTTCGCTGATT
TGGTCTTGGACCCGGTGACGCGGGAGACGCGGCGCGGTGACCGCTCGTTCCGCTTGAGCCCGCGCGAGTTCGATCTGCTC
TCGTACTTCATGCGGCATCCTCGCCGCGTGTTGACGCGGAATCAGATCCTGCTGGCAGTGTGGGGACACGACTTCGACGG
ATACGATAGCGTGCTCGATGTCTACATCGGCTATCTCCGACAGAAGCTGGAGGCCGGTGGGGAGCCCCGACTGATCCATA
CCGTCCGGGGTGTGGGCTATGTGTTGCGGGAGTCCTGA

Protein sequence :
MTHVLVVDDDTRLVEMLRRTLSYEGFTVSVAQSGDEALRLVAERRPDLIVLDWLLPGMDGLAVVQRLRAAGDGTPILMLT
ARDAVEDRVLGLDSGADDYLVKPFAPAELLARIRALLRRVEPASDEKPLVFADLVLDPVTRETRRGDRSFRLSPREFDLL
SYFMRHPRRVLTRNQILLAVWGHDFDGYDSVLDVYIGYLRQKLEAGGEPRLIHTVRGVGYVLRES

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 4e-27 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
trd_A0608 YP_002523890.1 response regulator BAC0125 Protein 4e-33 48
trd_A0608 YP_002523890.1 response regulator AE000516.2.gene3505. Protein 4e-33 48
trd_A0608 YP_002523890.1 response regulator BAC0111 Protein 3e-34 45
trd_A0608 YP_002523890.1 response regulator BAC0197 Protein 3e-29 45
trd_A0608 YP_002523890.1 response regulator BAC0347 Protein 1e-31 44
trd_A0608 YP_002523890.1 response regulator HE999704.1.gene1528. Protein 9e-34 43
trd_A0608 YP_002523890.1 response regulator BAC0083 Protein 5e-32 43
trd_A0608 YP_002523890.1 response regulator NC_002952.2859905.p0 Protein 2e-32 43
trd_A0608 YP_002523890.1 response regulator NC_007793.3914279.p0 Protein 3e-32 43
trd_A0608 YP_002523890.1 response regulator NC_003923.1003749.p0 Protein 3e-32 43
trd_A0608 YP_002523890.1 response regulator NC_002745.1124361.p0 Protein 3e-32 43
trd_A0608 YP_002523890.1 response regulator NC_009782.5559369.p0 Protein 3e-32 43
trd_A0608 YP_002523890.1 response regulator NC_002951.3237708.p0 Protein 3e-32 43
trd_A0608 YP_002523890.1 response regulator NC_007622.3794472.p0 Protein 2e-32 43
trd_A0608 YP_002523890.1 response regulator NC_002758.1121668.p0 Protein 3e-32 43
trd_A0608 YP_002523890.1 response regulator NC_009641.5332272.p0 Protein 3e-32 43
trd_A0608 YP_002523890.1 response regulator NC_013450.8614421.p0 Protein 3e-32 43
trd_A0608 YP_002523890.1 response regulator BAC0638 Protein 7e-26 42
trd_A0608 YP_002523890.1 response regulator BAC0487 Protein 4e-18 41
trd_A0608 YP_002523890.1 response regulator AE016830.1.gene1681. Protein 3e-33 41
trd_A0608 YP_002523890.1 response regulator NC_012469.1.7686381. Protein 7e-32 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
trd_A0608 YP_002523890.1 response regulator VFG1390 Protein 2e-53 59
trd_A0608 YP_002523890.1 response regulator VFG1389 Protein 1e-39 51
trd_A0608 YP_002523890.1 response regulator VFG1386 Protein 1e-42 47
trd_A0608 YP_002523890.1 response regulator VFG0596 Protein 2e-27 41