Gene Information

Name : BCQ_1947 (BCQ_1947)
Accession : YP_002529664.1
Strain : Bacillus cereus Q1
Genome accession: NC_011969
Putative virulence/resistance : Resistance
Product : response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1927936 - 1928640 bp
Length : 705 bp
Strand : +
Note : Code: TK; COG: COG0745

DNA sequence :
ATGCTACGTAGAAAGGAGAGGTTTTCTTTGCTACCAAAAATTTTAATAGTAGATGACGATCCACATATTAGAGAACTTGT
TTCTGTATTTTTAGAGCGGGAAGGATTTCAAACATATGAAGCAATTGATGGTCTAGATGCACTTCAAAAAATAGATGAAG
TGAAAGTTGATATGGTTATTCTTGATATCATGATGCCGAATATGGATGGATTTGATGTATGTTTTGAATTAAGGAAATAC
TATGATATTCCGATTTTGATGTTAACTGCTAAAGGAGAAACGTCTCAAAAAGTAAAAGGATTTCATCTTGGAACGGATGA
TTATCTTGTAAAACCATTTGATCCGATAGAACTAGTAGTGAGAGTTAAGGCGTTATTGAAACGTTACCAAATTACAGTAT
CGCAATCAATTCAAGTTGGAAATGTACTGTTAAATCGTAAAACATTTGAAGTTACAATTGGAGAACAAACAGTTACGTTA
CCACTAAAAGAATTCGAATTGCTCTTTACTTTAGGCTCTAAAACGGGGAGAACTTGTTCGAGAGAGCAATTAATTGAAGA
TGTATGGGGATATGATTTTGAAGGGAATGAGCGTACACTAGACGTTCATATAAATCGGTTACGTGAGAAGTTCCAAGAAG
AGAAGTCGAAATTTAGTATTAAAACGATAAGAGGCTTAGGATATCGCTTAGAGGTAAGTAAATGA

Protein sequence :
MLRRKERFSLLPKILIVDDDPHIRELVSVFLEREGFQTYEAIDGLDALQKIDEVKVDMVILDIMMPNMDGFDVCFELRKY
YDIPILMLTAKGETSQKVKGFHLGTDDYLVKPFDPIELVVRVKALLKRYQITVSQSIQVGNVLLNRKTFEVTIGEQTVTL
PLKEFELLFTLGSKTGRTCSREQLIEDVWGYDFEGNERTLDVHINRLREKFQEEKSKFSIKTIRGLGYRLEVSK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
vanRB YP_008394254.1 DNA-binding response regulator VanRB Not tested Not named Protein 7e-35 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BCQ_1947 YP_002529664.1 response regulator NC_003923.1003749.p0 Protein 5e-44 44
BCQ_1947 YP_002529664.1 response regulator NC_002952.2859905.p0 Protein 5e-44 43
BCQ_1947 YP_002529664.1 response regulator NC_013450.8614421.p0 Protein 7e-44 43
BCQ_1947 YP_002529664.1 response regulator NC_007793.3914279.p0 Protein 7e-44 43
BCQ_1947 YP_002529664.1 response regulator NC_002745.1124361.p0 Protein 7e-44 43
BCQ_1947 YP_002529664.1 response regulator NC_009782.5559369.p0 Protein 7e-44 43
BCQ_1947 YP_002529664.1 response regulator NC_002951.3237708.p0 Protein 7e-44 43
BCQ_1947 YP_002529664.1 response regulator NC_002758.1121668.p0 Protein 7e-44 43
BCQ_1947 YP_002529664.1 response regulator NC_007622.3794472.p0 Protein 5e-44 43
BCQ_1947 YP_002529664.1 response regulator NC_009641.5332272.p0 Protein 7e-44 43
BCQ_1947 YP_002529664.1 response regulator AF310956.2.orf0.gene Protein 3e-35 42
BCQ_1947 YP_002529664.1 response regulator AM180355.1.gene1830. Protein 2e-39 42
BCQ_1947 YP_002529664.1 response regulator NC_012469.1.7686381. Protein 2e-32 42
BCQ_1947 YP_002529664.1 response regulator HE999704.1.gene2815. Protein 8e-39 41
BCQ_1947 YP_002529664.1 response regulator AF162694.1.orf4.gene Protein 1e-33 41
BCQ_1947 YP_002529664.1 response regulator EU250284.1.orf4.gene Protein 2e-34 41
BCQ_1947 YP_002529664.1 response regulator NC_012469.1.7685629. Protein 1e-39 41