Gene Information

Name : BCQ_0489 (BCQ_0489)
Accession : YP_002528253.1
Strain : Bacillus cereus Q1
Genome accession: NC_011969
Putative virulence/resistance : Resistance
Product : tellurium resistance protein, terd family
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG2310
EC number : -
Position : 486327 - 486905 bp
Length : 579 bp
Strand : +
Note : Code: T; COG: COG2310

DNA sequence :
ATGGCTATTCAGTTACAAAAAGGACAAAAGATTGATTTAGGTAAGACGAGTCCTGGTTTAACAAAAGCGGTAATTGGTCT
TGGCTGGGATATTAAATCTTACGACGGTGGATCAGATTTCGATTTAGATGCATCAGCATTCCTATTAGATGCGAACGGAA
AATGTACAAAGGAAACTGATTTTATCTTCTATAATAATTTACAGTCTCCTTGTGGATCTGTTCTACATACAGGAGATAAC
CGCACAGGTGAAGGTGAAGGTGACGATGAACAACTTGTTGTGGACTTAAAGAAAGTTCCAGCAGATGTGCACAAAATTGC
TATTACAGTTACAATTTATGATGCAGAAGGCCGTAGTCAAAACTTTGGACAAGTAGGGAATGCGTTCGTTCGTTTAGCGA
ATGAAGAAACGAATGAAGAAGTTCTTCGTTTTGATTTAGGGGAAGATTTCTCCATCGAAACAGCAGTTGTCTTTTGTGAA
TTATACCGTCATAATGGACAGTGGAAGTTTAATGCAGTAGGAAGCGGATTCCAAGGTGGCTTAGGTGCGCTTGTAAGAGC
GTATGGCTTGGATGCATAG

Protein sequence :
MAIQLQKGQKIDLGKTSPGLTKAVIGLGWDIKSYDGGSDFDLDASAFLLDANGKCTKETDFIFYNNLQSPCGSVLHTGDN
RTGEGEGDDEQLVVDLKKVPADVHKIAITVTIYDAEGRSQNFGQVGNAFVRLANEETNEEVLRFDLGEDFSIETAVVFCE
LYRHNGQWKFNAVGSGFQGGLGALVRAYGLDA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 8e-45 58
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 8e-45 58
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 2e-48 58
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 2e-44 57
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 8e-43 55
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-42 55
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-42 55
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 1e-40 55

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BCQ_0489 YP_002528253.1 tellurium resistance protein, terd family BAC0389 Protein 6e-45 59
BCQ_0489 YP_002528253.1 tellurium resistance protein, terd family BAC0390 Protein 9e-44 54