Gene Information

Name : CTN_0732 (CTN_0732)
Accession : YP_002534274.1
Strain : Thermotoga neapolitana DSM 4359
Genome accession: NC_011978
Putative virulence/resistance : Virulence
Product : Response regulator DrrA
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 726384 - 727139 bp
Length : 756 bp
Strand : +
Note : -

DNA sequence :
ATGAAAGGAGGTGTACCCCTCTCAGGGGGATTGAAAATGGCGAAGAAGAAGATCCTGGTTGTCGACGATGACCCTGCAAT
TTTGGAACTGGTAGGATACAACCTGGCAAAGGAAGGCTACGACGTTCTGAAGGCGTACGATGGAGAAGAAGCGCTGAAAC
TTGCCAACGAAGAAGACGTGGACATGTTCATCGTGGATATTATGCTTCCGGGAATGGACGGGTTCGAACTGGTAAGAAAG
ATCAGATCTATGGAAAAATACAGAAACACTCCGGTTATCTTTCTGAGCGCAAAGGGTGAAGAGTTCGACAAGGTTCTTGG
ATTGGAACTTGGAGCCGACGACTACATAACGAAACCCTTCAGCGTGAGAGAGCTTCTTGCAAGGGTGAAGGCTATATTCA
GAAGACTGTCTGCTGCCGTGCAGAGCAAGGAGGAAAGACCCAAAAAGATCACTGCAAAGGATCTCGAGATCGATGTGGAG
AAATACGAAGTGAAAGTGAGAGGAAAGAAAGTGAACCTCACACCTCTGGAATTCGAACTTCTGAGGTTTCTGGCAGAAAA
TGAAGGAAAGGTTTTCAGCAGGGATGTGCTTCTCGACAAGCTGTGGGGGTACGACTACTACGGTGACACGAGAACGGTCG
ATGTGCACATCAGAAGGTTGAGAACGAAGATAGAAGAAGACCCATCGAACCCGAAATACATCATCACCGTTCGTGGAAAA
GGTTACAAGTTCAGAGATCCTGGAAAGGAAGAATGA

Protein sequence :
MKGGVPLSGGLKMAKKKILVVDDDPAILELVGYNLAKEGYDVLKAYDGEEALKLANEEDVDMFIVDIMLPGMDGFELVRK
IRSMEKYRNTPVIFLSAKGEEFDKVLGLELGADDYITKPFSVRELLARVKAIFRRLSAAVQSKEERPKKITAKDLEIDVE
KYEVKVRGKKVNLTPLEFELLRFLAENEGKVFSRDVLLDKLWGYDYYGDTRTVDVHIRRLRTKIEEDPSNPKYIITVRGK
GYKFRDPGKEE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 4e-44 49
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 8e-44 48
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 3e-37 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
CTN_0732 YP_002534274.1 Response regulator DrrA HE999704.1.gene2815. Protein 2e-50 52
CTN_0732 YP_002534274.1 Response regulator DrrA NC_012469.1.7685629. Protein 7e-54 51
CTN_0732 YP_002534274.1 Response regulator DrrA AE016830.1.gene1681. Protein 2e-54 50
CTN_0732 YP_002534274.1 Response regulator DrrA AF155139.2.orf0.gene Protein 6e-47 48
CTN_0732 YP_002534274.1 Response regulator DrrA NC_002952.2859905.p0 Protein 4e-50 48
CTN_0732 YP_002534274.1 Response regulator DrrA NC_013450.8614421.p0 Protein 5e-50 48
CTN_0732 YP_002534274.1 Response regulator DrrA NC_007793.3914279.p0 Protein 5e-50 48
CTN_0732 YP_002534274.1 Response regulator DrrA NC_003923.1003749.p0 Protein 5e-50 48
CTN_0732 YP_002534274.1 Response regulator DrrA NC_007622.3794472.p0 Protein 4e-50 48
CTN_0732 YP_002534274.1 Response regulator DrrA NC_002745.1124361.p0 Protein 5e-50 48
CTN_0732 YP_002534274.1 Response regulator DrrA NC_009782.5559369.p0 Protein 5e-50 48
CTN_0732 YP_002534274.1 Response regulator DrrA NC_002951.3237708.p0 Protein 5e-50 48
CTN_0732 YP_002534274.1 Response regulator DrrA NC_002758.1121668.p0 Protein 5e-50 48
CTN_0732 YP_002534274.1 Response regulator DrrA NC_009641.5332272.p0 Protein 5e-50 48
CTN_0732 YP_002534274.1 Response regulator DrrA NC_012469.1.7686381. Protein 7e-47 46
CTN_0732 YP_002534274.1 Response regulator DrrA AM180355.1.gene1830. Protein 4e-41 45
CTN_0732 YP_002534274.1 Response regulator DrrA NC_014475.1.orf0.gen Protein 4e-44 45
CTN_0732 YP_002534274.1 Response regulator DrrA NC_005054.2598277.p0 Protein 4e-44 45
CTN_0732 YP_002534274.1 Response regulator DrrA AE000516.2.gene3505. Protein 6e-41 44
CTN_0732 YP_002534274.1 Response regulator DrrA FJ349556.1.orf0.gene Protein 3e-43 43
CTN_0732 YP_002534274.1 Response regulator DrrA DQ212986.1.gene4.p01 Protein 6e-40 43
CTN_0732 YP_002534274.1 Response regulator DrrA BAC0125 Protein 5e-35 43
CTN_0732 YP_002534274.1 Response regulator DrrA AF130997.1.orf0.gene Protein 3e-37 43
CTN_0732 YP_002534274.1 Response regulator DrrA AF162694.1.orf4.gene Protein 8e-38 43
CTN_0732 YP_002534274.1 Response regulator DrrA BAC0197 Protein 2e-33 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
CTN_0732 YP_002534274.1 Response regulator DrrA VFG1702 Protein 2e-44 49
CTN_0732 YP_002534274.1 Response regulator DrrA VFG1563 Protein 5e-44 48
CTN_0732 YP_002534274.1 Response regulator DrrA VFG1389 Protein 1e-33 44
CTN_0732 YP_002534274.1 Response regulator DrrA VFG0596 Protein 1e-37 41
CTN_0732 YP_002534274.1 Response regulator DrrA VFG1386 Protein 7e-39 41