Gene Information

Name : Geob_3553 (Geob_3553)
Accession : YP_002538995.1
Strain : Geobacter daltonii FRC-32
Genome accession: NC_011979
Putative virulence/resistance : Resistance
Product : two component transcriptional regulator, winged helix family
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 3940396 - 3941073 bp
Length : 678 bp
Strand : +
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: gsu:GSU1102 DNA-binding response regulator

DNA sequence :
ATGAAAACGATCCTTGTTATAGAGGATGAGCGGGATCTGGCAGAATTGATAGCCTTCAACCTGGAAAAGGAAGGTTTCCG
CTGCCTGCGGGAAGCCGATGGGACCTCGGGACTCGAAACGGCACGCAGTGAATTACCGGATCTGATACTACTCGATCTGA
TGCTGCCTGGTCTCATGGGCACCGAAATCTGCAAGATACTTAAGAAAAATGAAAAAACCGCCACCATTCCCATCATGATG
CTGACAGCGCGCGGTGAAGAGATCGACAGGGTTGTTGGGTTCGAGGTGGGAGCCGACGACTATATCGTCAAGCCGTTCTC
TATCAGGGAGCTGCTTCTGCGGATCAGAGCAGTTCTGCGGCGTGCCGCTCCCGCCGCACCAGCCTGCAAACTGGTCATAG
GTCCGGTGCATATGGATACCGAACGTCACCAGGTTCTCATTGAAAATGAAGAAATTACCCTTACCACAACCGAATTCAAG
CTGCTCCTCAACCTGGTCGAACGCCGCGGCCGGGTGCAGAGCAGAGAAACGCTGCTCCAGGATGTCTGGGGGTATAACTA
CGTGGGTGACACACGGACCGTGGACACCCACGTGACAAGGCTAAGGACTAAACTGGGGCAGGCAGGGGAAATGATCAAGA
CCATCAGGGGCTTCGGTTATAAGATGGAGGAGCAATGA

Protein sequence :
MKTILVIEDERDLAELIAFNLEKEGFRCLREADGTSGLETARSELPDLILLDLMLPGLMGTEICKILKKNEKTATIPIMM
LTARGEEIDRVVGFEVGADDYIVKPFSIRELLLRIRAVLRRAAPAAPACKLVIGPVHMDTERHQVLIENEEITLTTTEFK
LLLNLVERRGRVQSRETLLQDVWGYNYVGDTRTVDTHVTRLRTKLGQAGEMIKTIRGFGYKMEEQ

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
vanRB YP_001698483.1 regulatory protein Not tested Not named Protein 7e-18 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Geob_3553 YP_002538995.1 two component transcriptional regulator, winged helix family HE999704.1.gene1528. Protein 3e-22 45
Geob_3553 YP_002538995.1 two component transcriptional regulator, winged helix family HE999704.1.gene2815. Protein 5e-32 45
Geob_3553 YP_002538995.1 two component transcriptional regulator, winged helix family AE015929.1.gene1106. Protein 2e-17 44
Geob_3553 YP_002538995.1 two component transcriptional regulator, winged helix family NC_002951.3237708.p0 Protein 2e-32 44
Geob_3553 YP_002538995.1 two component transcriptional regulator, winged helix family NC_002758.1121668.p0 Protein 2e-32 44
Geob_3553 YP_002538995.1 two component transcriptional regulator, winged helix family NC_009641.5332272.p0 Protein 2e-32 44
Geob_3553 YP_002538995.1 two component transcriptional regulator, winged helix family NC_013450.8614421.p0 Protein 2e-32 44
Geob_3553 YP_002538995.1 two component transcriptional regulator, winged helix family NC_007793.3914279.p0 Protein 2e-32 44
Geob_3553 YP_002538995.1 two component transcriptional regulator, winged helix family NC_003923.1003749.p0 Protein 2e-32 44
Geob_3553 YP_002538995.1 two component transcriptional regulator, winged helix family NC_002745.1124361.p0 Protein 2e-32 44
Geob_3553 YP_002538995.1 two component transcriptional regulator, winged helix family NC_009782.5559369.p0 Protein 2e-32 44
Geob_3553 YP_002538995.1 two component transcriptional regulator, winged helix family AE000516.2.gene3505. Protein 4e-27 44
Geob_3553 YP_002538995.1 two component transcriptional regulator, winged helix family NC_002952.2859858.p0 Protein 2e-20 43
Geob_3553 YP_002538995.1 two component transcriptional regulator, winged helix family NC_007622.3794948.p0 Protein 2e-20 43
Geob_3553 YP_002538995.1 two component transcriptional regulator, winged helix family NC_003923.1003417.p0 Protein 2e-20 43
Geob_3553 YP_002538995.1 two component transcriptional regulator, winged helix family NC_013450.8614146.p0 Protein 2e-20 43
Geob_3553 YP_002538995.1 two component transcriptional regulator, winged helix family NC_002951.3238224.p0 Protein 2e-20 43
Geob_3553 YP_002538995.1 two component transcriptional regulator, winged helix family NC_007793.3914065.p0 Protein 2e-20 43
Geob_3553 YP_002538995.1 two component transcriptional regulator, winged helix family NC_002758.1121390.p0 Protein 2e-20 43
Geob_3553 YP_002538995.1 two component transcriptional regulator, winged helix family NC_010079.5776364.p0 Protein 2e-20 43
Geob_3553 YP_002538995.1 two component transcriptional regulator, winged helix family NC_002952.2859905.p0 Protein 3e-32 43
Geob_3553 YP_002538995.1 two component transcriptional regulator, winged helix family NC_007622.3794472.p0 Protein 3e-32 43
Geob_3553 YP_002538995.1 two component transcriptional regulator, winged helix family AE016830.1.gene1681. Protein 2e-31 42