Gene Information

Name : Geob_0409 (Geob_0409)
Accession : YP_002535879.1
Strain : Geobacter daltonii FRC-32
Genome accession: NC_011979
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator, winged helix family
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 486285 - 486959 bp
Length : 675 bp
Strand : -
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: gur:Gura_4293 two component transcriptional regulator

DNA sequence :
ATGAGAATTCTGGTAGTGGAAGATGAAAAAAAAGTACTTAGCTTCATTAAGCGGGGGCTGGAAGAGGAGCAGTATGAGGT
TGTGACTGCAGGAGACGGCGAGGAAGGGCTGAAAATGGCCATGGAAAAGAACTTCGACCTGCTAATCCTCGACTGGATGC
TCCCCAAGATGGATGGGCTCAGTGTACTCAAGGAGCTGAAGAGCCAGAAAAATACCACTCCGGTCCTCATGCTTACCGCC
AAAGACTCGGTAGAAGACATCGTTGCCGGCCTCGATTCGGGATCGGACGATTATCTGACCAAGCCTTTTGCCTTTGCCGA
ACTCCTGGCCAGGGTCAGAGCACTGCTGCGCCGAAGCGAGCAGGACCGTGGTGCAGAGATTCGATTCAGCGACCTGCGTC
TTGACCCGGTGACCCACAAGGTCTGGCGCAAGGACAAGGAGATCGACCTGACAGCCAAGGAGTATGGTCTCCTCGAGTAC
TTCATGCGCAACCCCCACGAAGTGCTGACCCGAACCATGATTGCCGAGCATGTCTGGGATTACACCTTCGACAGCTTTAC
CAACATCATCGATGTTTATGTCAACTACCTGCGCAAAAAGATCGACAGAGATGCCGACAAAAAACTTATTCATACTGTAA
GAGGCGTCGGATATATCCTTAAAGAGGAGGATTGA

Protein sequence :
MRILVVEDEKKVLSFIKRGLEEEQYEVVTAGDGEEGLKMAMEKNFDLLILDWMLPKMDGLSVLKELKSQKNTTPVLMLTA
KDSVEDIVAGLDSGSDDYLTKPFAFAELLARVRALLRRSEQDRGAEIRFSDLRLDPVTHKVWRKDKEIDLTAKEYGLLEY
FMRNPHEVLTRTMIAEHVWDYTFDSFTNIIDVYVNYLRKKIDRDADKKLIHTVRGVGYILKEED

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-33 46
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 4e-32 44

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Geob_0409 YP_002535879.1 two component transcriptional regulator, winged helix family BAC0125 Protein 1e-40 50
Geob_0409 YP_002535879.1 two component transcriptional regulator, winged helix family BAC0111 Protein 7e-40 50
Geob_0409 YP_002535879.1 two component transcriptional regulator, winged helix family BAC0308 Protein 1e-36 50
Geob_0409 YP_002535879.1 two component transcriptional regulator, winged helix family BAC0638 Protein 1e-32 49
Geob_0409 YP_002535879.1 two component transcriptional regulator, winged helix family BAC0347 Protein 4e-34 48
Geob_0409 YP_002535879.1 two component transcriptional regulator, winged helix family BAC0197 Protein 3e-34 48
Geob_0409 YP_002535879.1 two component transcriptional regulator, winged helix family BAC0083 Protein 2e-38 47
Geob_0409 YP_002535879.1 two component transcriptional regulator, winged helix family AE015929.1.gene1106. Protein 2e-28 44
Geob_0409 YP_002535879.1 two component transcriptional regulator, winged helix family NC_010079.5776364.p0 Protein 1e-32 43
Geob_0409 YP_002535879.1 two component transcriptional regulator, winged helix family NC_002952.2859858.p0 Protein 1e-32 43
Geob_0409 YP_002535879.1 two component transcriptional regulator, winged helix family NC_007622.3794948.p0 Protein 1e-32 43
Geob_0409 YP_002535879.1 two component transcriptional regulator, winged helix family NC_003923.1003417.p0 Protein 1e-32 43
Geob_0409 YP_002535879.1 two component transcriptional regulator, winged helix family NC_013450.8614146.p0 Protein 1e-32 43
Geob_0409 YP_002535879.1 two component transcriptional regulator, winged helix family NC_002951.3238224.p0 Protein 1e-32 43
Geob_0409 YP_002535879.1 two component transcriptional regulator, winged helix family NC_007793.3914065.p0 Protein 1e-32 43
Geob_0409 YP_002535879.1 two component transcriptional regulator, winged helix family NC_002758.1121390.p0 Protein 1e-32 43
Geob_0409 YP_002535879.1 two component transcriptional regulator, winged helix family HE999704.1.gene1528. Protein 2e-36 43
Geob_0409 YP_002535879.1 two component transcriptional regulator, winged helix family NC_002952.2859905.p0 Protein 9e-33 42
Geob_0409 YP_002535879.1 two component transcriptional regulator, winged helix family NC_002758.1121668.p0 Protein 1e-32 42
Geob_0409 YP_002535879.1 two component transcriptional regulator, winged helix family NC_007622.3794472.p0 Protein 7e-33 42
Geob_0409 YP_002535879.1 two component transcriptional regulator, winged helix family NC_009641.5332272.p0 Protein 1e-32 42
Geob_0409 YP_002535879.1 two component transcriptional regulator, winged helix family NC_013450.8614421.p0 Protein 1e-32 42
Geob_0409 YP_002535879.1 two component transcriptional regulator, winged helix family NC_007793.3914279.p0 Protein 1e-32 42
Geob_0409 YP_002535879.1 two component transcriptional regulator, winged helix family NC_003923.1003749.p0 Protein 1e-32 42
Geob_0409 YP_002535879.1 two component transcriptional regulator, winged helix family NC_002745.1124361.p0 Protein 1e-32 42
Geob_0409 YP_002535879.1 two component transcriptional regulator, winged helix family NC_009782.5559369.p0 Protein 1e-32 42
Geob_0409 YP_002535879.1 two component transcriptional regulator, winged helix family NC_002951.3237708.p0 Protein 1e-32 42
Geob_0409 YP_002535879.1 two component transcriptional regulator, winged helix family HE999704.1.gene2815. Protein 3e-31 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Geob_0409 YP_002535879.1 two component transcriptional regulator, winged helix family VFG1390 Protein 2e-46 52
Geob_0409 YP_002535879.1 two component transcriptional regulator, winged helix family VFG0596 Protein 9e-34 46
Geob_0409 YP_002535879.1 two component transcriptional regulator, winged helix family VFG1386 Protein 4e-42 42