
|
Name : fliQ (Avi_0770) Accession : YP_002548552.1 Strain : Genome accession: NC_011989 Putative virulence/resistance : Virulence Product : flagellar biosynthesis protein FliQ Function : - COG functional category : N : Cell motility COG ID : COG1987 EC number : - Position : 658474 - 658740 bp Length : 267 bp Strand : + Note : FliQ, with proteins FliP and FliR, forms the core of the central channel in the flagella export apparatus; Bradyrhizobium have one thick flagellum and several thin flagella; the protein in this cluster is associated with the thick flagellum DNA sequence : ATGAATGAAGCAGATGCCCTCGATATCATGCGCGCCGCTGTATGGACCGTGCTGATTGCCTCGGGGCCAGCCGTTCTGGC CGCGATGATCGTCGGCGTCGTGGTCGCCTTGATCCAGGCATTGACCCAGATCCAGGAAATGACCCTGACATTCGTCCCAA AAATCGTTGCGATCATGGTGACGATCGGTATTTCCGCTCCCTTTGTCGGGTCTCAAATTTCGATTTTTGCCAATCTGGTG TTTTCCCGGGTCCAATCCGGCTTTTAA Protein sequence : MNEADALDIMRAAVWTVLIASGPAVLAAMIVGVVVALIQALTQIQEMTLTFVPKIVAIMVTIGISAPFVGSQISIFANLV FSRVQSGF |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| lscS | AAO18039.1 | LscS | Virulence | TTSS locus | Protein | 3e-12 | 48 |
| Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
| fliQ | YP_002548552.1 | flagellar biosynthesis protein FliQ | VFG0395 | Protein | 2e-12 | 42 |
| fliQ | YP_002548552.1 | flagellar biosynthesis protein FliQ | VFG0187 | Protein | 2e-07 | 42 |
| fliQ | YP_002548552.1 | flagellar biosynthesis protein FliQ | VFG2132 | Protein | 6e-05 | 42 |