Gene Information

Name : Dtpsy_2129 (Dtpsy_2129)
Accession : YP_002553582.1
Strain : Acidovorax ebreus TPSY
Genome accession: NC_011992
Putative virulence/resistance : Resistance
Product : MerR family transcriptional regulator
Function : -
COG functional category : K : Transcription
COG ID : COG0789
EC number : -
Position : 2278571 - 2279005 bp
Length : 435 bp
Strand : -
Note : KEGG: sew:SeSA_B0083 Hg(II)-responsive transcriptional regulator; TIGRFAM: Hg(II)-responsive transcriptional regulator; PFAM: regulatory protein MerR; Transcription regulator MerR DNA binding; SMART: regulatory protein MerR

DNA sequence :
ATGGAAAATAATTTGGAAAACCTGACCATTGGCGTTTTTGCCAAGGCGGCCGGGGTCAACGTGGAGACAATCCGCTTCTA
TCAGCGCAAGGGCCTGTTGCCGGAACCGGACAAGCCTTACGGCAGCATCCGCCGCTATGGGGAGGCGGACGTGGTTCGGG
TGAAATTCGTGAAATCGGCACAGCGGCTGGGGTTCAGTCTGGACGAGATTGCCGAGCTGTTGCGGCTCGACGATGGCACC
CACTGCGAGGAGGCCAGCAGCCTGGCCGAACACAAGCTCAAGGACGTGCGCGAGAAGATGGCCGACTTGGCGCGCATGGA
AACCGTGCTGTCTGAACTCGTGTGCGCCTGCCATGCACGAAAGGGGAATGTTTCCTGCCCGTTGATCGCGTCACTACAGG
GCGAAGCAGGCCTGGCAAGGTCAGCTATGCCTTAG

Protein sequence :
MENNLENLTIGVFAKAAGVNVETIRFYQRKGLLPEPDKPYGSIRRYGEADVVRVKFVKSAQRLGFSLDEIAELLRLDDGT
HCEEASSLAEHKLKDVREKMADLARMETVLSELVCACHARKGNVSCPLIASLQGEAGLARSAMP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
merR AFG30124.1 MerR Not tested PAGI-2 Protein 7e-63 99
merR AGK07025.1 MerR Not tested SGI1 Protein 3e-62 99
merR AGK07083.1 MerR Not tested SGI1 Protein 3e-62 99
merR ACK44535.1 MerR Not tested SGI1 Protein 7e-63 99
merR AET25401.1 MerR Not tested PAGI-2(C) Protein 7e-63 99
merR YP_006098391.1 mercuric resistance operon transcriptional regulator Not tested Tn2411 Protein 1e-62 99
merR CAJ77064.1 Mercury resistance operon regulatory protein Not tested AbaR1 Protein 5e-58 91
merR ACN81009.1 MerR activator/repressor of mer operon Not tested AbaR5 Protein 8e-58 91
unnamed ABR13397.1 mercuric resistance operon regulatory protein Not tested PAGI-5 Protein 3e-48 79
merR AAN62181.1 organomercurial resistance regulatory protein MerR Not tested PAGI-2(C) Protein 6e-46 74
EXB37 ABD94723.1 putative regulator of mercury resistance conferring proteins Not tested ExoU island B Protein 4e-27 47

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Dtpsy_2129 YP_002553582.1 MerR family transcriptional regulator BAC0686 Protein 5e-57 95
Dtpsy_2129 YP_002553582.1 MerR family transcriptional regulator BAC0688 Protein 1e-58 95
Dtpsy_2129 YP_002553582.1 MerR family transcriptional regulator BAC0687 Protein 3e-60 94
Dtpsy_2129 YP_002553582.1 MerR family transcriptional regulator BAC0232 Protein 3e-60 94
Dtpsy_2129 YP_002553582.1 MerR family transcriptional regulator BAC0684 Protein 4e-59 93
Dtpsy_2129 YP_002553582.1 MerR family transcriptional regulator BAC0683 Protein 6e-60 91
Dtpsy_2129 YP_002553582.1 MerR family transcriptional regulator BAC0689 Protein 8e-56 89