
|
Name : Dtpsy_2131 (Dtpsy_2131) Accession : YP_002553584.1 Strain : Acidovorax ebreus TPSY Genome accession: NC_011992 Putative virulence/resistance : Resistance Product : mercuric transport protein periplasmic component Function : - COG functional category : P : Inorganic ion transport and metabolism COG ID : COG2608 EC number : - Position : 2279441 - 2279716 bp Length : 276 bp Strand : + Note : TIGRFAM: mercuric transport protein periplasmic component; PFAM: Heavy metal transport/detoxification protein; KEGG: sew:SeSA_B0081 mercuric transport protein periplasmic component DNA sequence : ATGAAGAAACTGTTTGCCTCCCTTGCCCTCGCCGCCGCTGTTGCCCCGGTGTGGGCCGCTACCCAGACCGTCACGCTAGC GGTTCCCGGCATGACTTGCGCCGCCTGCCCGATCACAGTCAAGAAAGCGCTCTCCAAGGTCGAAGGCGTGAGCAAGGTCG ATGTGGGCTTCGAGAAGCGCGAGGCCGTCGTCACTTTTGACGACACCAAGGCCAGCGTACAGAAGCTGACCAAGGCCACC GCAGACGCCGGCTATCCGTCCAGCGTCAAGCAGTGA Protein sequence : MKKLFASLALAAAVAPVWAATQTVTLAVPGMTCAACPITVKKALSKVEGVSKVDVGFEKREAVVTFDDTKASVQKLTKAT ADAGYPSSVKQ |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| merP | ABQ57373.1 | MerP | Not tested | SGI1 | Protein | 7e-25 | 100 |
| merP | AET25399.1 | MerP | Not tested | PAGI-2(C) | Protein | 7e-25 | 100 |
| merP | AFG30122.1 | MerP | Not tested | PAGI-2 | Protein | 7e-25 | 100 |
| merP | AGK07023.1 | MerP | Not tested | SGI1 | Protein | 7e-25 | 100 |
| merP | AGK07081.1 | MerP | Not tested | SGI1 | Protein | 7e-25 | 100 |
| merP | YP_006098389.1 | mercuric ion transport protein | Not tested | Tn2411 | Protein | 1e-24 | 100 |
| merP | ACN81007.1 | MerP periplasmic mercuric ion binding protein | Not tested | AbaR5 | Protein | 1e-21 | 81 |
| merP | CAJ77062.1 | Periplasmic mercuric ion binding protein | Not tested | AbaR1 | Protein | 7e-22 | 81 |
| unnamed | ABR13399.1 | copper-transporting ATPase 2 | Not tested | PAGI-5 | Protein | 5e-22 | 81 |
| Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
| Dtpsy_2131 | YP_002553584.1 | mercuric transport protein periplasmic component | BAC0678 | Protein | 7e-23 | 88 |
| Dtpsy_2131 | YP_002553584.1 | mercuric transport protein periplasmic component | BAC0679 | Protein | 1e-22 | 88 |
| Dtpsy_2131 | YP_002553584.1 | mercuric transport protein periplasmic component | BAC0231 | Protein | 3e-22 | 85 |
| Dtpsy_2131 | YP_002553584.1 | mercuric transport protein periplasmic component | BAC0675 | Protein | 4e-19 | 70 |
| Dtpsy_2131 | YP_002553584.1 | mercuric transport protein periplasmic component | BAC0674 | Protein | 8e-16 | 60 |