Gene Information

Name : Dtpsy_2201 (Dtpsy_2201)
Accession : YP_002553641.1
Strain : Acidovorax ebreus TPSY
Genome accession: NC_011992
Putative virulence/resistance : Virulence
Product : winged helix family two component heavy metal response transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2340608 - 2341291 bp
Length : 684 bp
Strand : +
Note : KEGG: ajs:Ajs_2725 two component heavy metal response transcriptional regulator; TIGRFAM: heavy metal response regulator; PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receiver

DNA sequence :
GTGAAGATATTGATCGTCGAGGACGAGCCCAAGACCGGGGCCTACCTGCGCCAGGGGTTGAGCGAGGCGGGCTACAGCTG
CGACCTGGTGCCCAATGGCGGGGATGGACTGCACATGGCCATCCATGGCCAGTACGACTTGGTGATTCTGGATGTCATGC
TGCCGGGCCTGAACGGCTGGCAGGTGCTGCAGTCCCTGCGTGACCGGGGCCTGGAAATGCCCGTGCTGTTCCTGACCGCC
CGCGACCAGGTAGAGGACCGTGTCAAGGGCCTGGAGCTGGGGGCCGATGACTATCTGGTCAAGCCGTTTTCGTTTGCCGA
ACTGCTGGCCAGGGTGCGCATCATTCTGCGGCGCGGCCATGCCGGCAGCGAAGGCACGACACTGCGCGTAGCCGATCTGG
AGCTCGATCTGCTGCGCCGCCGGGTGTCCCGCAATGGCCGGCGCGTGGACCTGACGGCCAAGGAATTTGGCCTGCTGGAG
CTGCTGATGCGCCGCCATGGCGAGGTGTTGCCGCGCTCGCTCATCGCATCGCAGGTATGGGACATGAACTTCGACAGCGA
CACCAACGTCATCGAAGTCGCCATGCGCCGCCTGCGCGTGAAGATTGATGAAGGCCATCCGGTCAAGCTCATCCAGACCG
TGCGCGGCATGGGCTATGTGCTGGATCTGCCCGAGGAGGCCTGA

Protein sequence :
MKILIVEDEPKTGAYLRQGLSEAGYSCDLVPNGGDGLHMAIHGQYDLVILDVMLPGLNGWQVLQSLRDRGLEMPVLFLTA
RDQVEDRVKGLELGADDYLVKPFSFAELLARVRIILRRGHAGSEGTTLRVADLELDLLRRRVSRNGRRVDLTAKEFGLLE
LLMRRHGEVLPRSLIASQVWDMNFDSDTNVIEVAMRRLRVKIDEGHPVKLIQTVRGMGYVLDLPEEA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-54 59
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 9e-54 58

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Dtpsy_2201 YP_002553641.1 winged helix family two component heavy metal response transcriptional regulator BAC0197 Protein 2e-68 68
Dtpsy_2201 YP_002553641.1 winged helix family two component heavy metal response transcriptional regulator BAC0638 Protein 9e-64 68
Dtpsy_2201 YP_002553641.1 winged helix family two component heavy metal response transcriptional regulator BAC0083 Protein 4e-69 66
Dtpsy_2201 YP_002553641.1 winged helix family two component heavy metal response transcriptional regulator BAC0308 Protein 3e-64 64
Dtpsy_2201 YP_002553641.1 winged helix family two component heavy metal response transcriptional regulator BAC0111 Protein 9e-65 64
Dtpsy_2201 YP_002553641.1 winged helix family two component heavy metal response transcriptional regulator BAC0125 Protein 1e-65 63
Dtpsy_2201 YP_002553641.1 winged helix family two component heavy metal response transcriptional regulator BAC0347 Protein 1e-59 60
Dtpsy_2201 YP_002553641.1 winged helix family two component heavy metal response transcriptional regulator BAC0487 Protein 2e-31 41
Dtpsy_2201 YP_002553641.1 winged helix family two component heavy metal response transcriptional regulator NC_002951.3238224.p0 Protein 4e-34 41
Dtpsy_2201 YP_002553641.1 winged helix family two component heavy metal response transcriptional regulator NC_007793.3914065.p0 Protein 4e-34 41
Dtpsy_2201 YP_002553641.1 winged helix family two component heavy metal response transcriptional regulator NC_002758.1121390.p0 Protein 4e-34 41
Dtpsy_2201 YP_002553641.1 winged helix family two component heavy metal response transcriptional regulator NC_010079.5776364.p0 Protein 4e-34 41
Dtpsy_2201 YP_002553641.1 winged helix family two component heavy metal response transcriptional regulator NC_002952.2859858.p0 Protein 4e-34 41
Dtpsy_2201 YP_002553641.1 winged helix family two component heavy metal response transcriptional regulator NC_007622.3794948.p0 Protein 4e-34 41
Dtpsy_2201 YP_002553641.1 winged helix family two component heavy metal response transcriptional regulator NC_003923.1003417.p0 Protein 4e-34 41
Dtpsy_2201 YP_002553641.1 winged helix family two component heavy metal response transcriptional regulator NC_013450.8614146.p0 Protein 4e-34 41
Dtpsy_2201 YP_002553641.1 winged helix family two component heavy metal response transcriptional regulator NC_002516.2.879194.p Protein 4e-30 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Dtpsy_2201 YP_002553641.1 winged helix family two component heavy metal response transcriptional regulator VFG0596 Protein 4e-55 59
Dtpsy_2201 YP_002553641.1 winged helix family two component heavy metal response transcriptional regulator VFG1390 Protein 4e-40 46
Dtpsy_2201 YP_002553641.1 winged helix family two component heavy metal response transcriptional regulator VFG1386 Protein 4e-36 43
Dtpsy_2201 YP_002553641.1 winged helix family two component heavy metal response transcriptional regulator VFG1389 Protein 4e-34 43
Dtpsy_2201 YP_002553641.1 winged helix family two component heavy metal response transcriptional regulator VFG0473 Protein 7e-33 41