Gene Information

Name : Dtpsy_2887 (Dtpsy_2887)
Accession : YP_002554321.1
Strain : Acidovorax ebreus TPSY
Genome accession: NC_011992
Putative virulence/resistance : Resistance
Product : arsenate reductase
Function : -
COG functional category : P : Inorganic ion transport and metabolism
COG ID : COG1393
EC number : -
Position : 3068782 - 3069138 bp
Length : 357 bp
Strand : -
Note : TIGRFAM: arsenate reductase; PFAM: arsenate reductase and related; KEGG: ajs:Ajs_3564 arsenate reductase

DNA sequence :
ATGACCTCTGCCGCCATCACCATCTACCACAACGCCCGCTGCAGCAATTCGCGCGGCGCCTTGGCGCTGCTGCGCGAGCG
CGGAATCGAGCCCACCGTCGTGGACTATCTCGCCCAGCCGCTGGATGCCGTCCAGCTCACCGCCTTGGTGGCGCGCCTGG
GCGTGCCCGTGCGCGAAGTCATGCGCACCAAGGAGGCCGCCTACACCGCGCTGGATCTGGCCGACCCGGGCCGCACCGAT
GCCGAGCTCATTGCCGCCATCGCCGCGCACCCGGTGCTGCTCAACCGCCCCATCGTCGTGACGCCGCGCGGTGCCCTGCT
GTGCCGCCCGCCCGAGCGGGTGCTGGAGTTGCTCTGA

Protein sequence :
MTSAAITIYHNARCSNSRGALALLRERGIEPTVVDYLAQPLDAVQLTALVARLGVPVREVMRTKEAAYTALDLADPGRTD
AELIAAIAAHPVLLNRPIVVTPRGALLCRPPERVLELL

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
arsC2 YP_001007634.1 arsenate reductase Not tested YAPI Protein 4e-23 47
arsC ADZ05768.1 arsenate reductase Not tested AbaR11 Protein 9e-22 42
arsC AFC76436.1 ArsC Not tested AbaR5 Protein 8e-22 42
arsR CAJ77019.1 arsenate reductase Not tested AbaR1 Protein 6e-22 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Dtpsy_2887 YP_002554321.1 arsenate reductase BAC0583 Protein 4e-25 48
Dtpsy_2887 YP_002554321.1 arsenate reductase BAC0582 Protein 2e-24 47
Dtpsy_2887 YP_002554321.1 arsenate reductase BAC0584 Protein 6e-25 47
Dtpsy_2887 YP_002554321.1 arsenate reductase BAC0585 Protein 1e-24 47