Gene Information

Name : Chy400_1981 (Chy400_1981)
Accession : YP_002569712.1
Strain : Chloroflexus sp. Y-400-fl
Genome accession: NC_012032
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2514932 - 2515612 bp
Length : 681 bp
Strand : -
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: cau:Caur_1833 response regulator receiver

DNA sequence :
ATGAATATTTTGGTTGTTGATGATGACATCCCCAGTGCAAGAATGACTTCTTACTTGCTTGAAGAAGCTGGTTATCGTGT
ATTTCGGGCACACGATGCATCCAACATTCTCCAGTTGATCGAGCAACACAATCCCGATCTCATCTTGCTGGATGTCATGA
TGCCTAAAATTGATGGGTTCGAGGTTTGTCGCCAGATTCGACGCAACTCCGACATTCCGATCATCTTCCTCTCGGCTCGC
CATCAACTCCAGGATCGGGTGATGGGGCTTCAAATCGGTGGTGACGACTATCTGGTCAAACCGTTTGAACCTTCGGAATT
GCTGGCGCGTGTTGAAGCTGTCTTACGACGACGCAACGCCGATGTGCTCAACACCTCGACCCGTCTCAGTCAGGGCAATA
TCACGCTCGATCCCGTCGAACACAAAGTTCTCTTCACCGACGGTCGCGTTGTGGAATTGACCCCACTCGAATTTCGATTG
CTCTACTACCTGATGAAGAATTCGGGACGCATCTTGAACGTAACCCAAATTTTGAGTAAAGTATGGGGGTACGACTACGA
AGGTGAAAGCAATCTGGTCGCCGTCTACATCCGCCGTCTGCGTACAAAGGTAGAGGAAGACCCGGATCATCCACGTCACG
TCATTACAGTACGTAATCTCGGCTATAAGTTTGAGCCATAG

Protein sequence :
MNILVVDDDIPSARMTSYLLEEAGYRVFRAHDASNILQLIEQHNPDLILLDVMMPKIDGFEVCRQIRRNSDIPIIFLSAR
HQLQDRVMGLQIGGDDYLVKPFEPSELLARVEAVLRRRNADVLNTSTRLSQGNITLDPVEHKVLFTDGRVVELTPLEFRL
LYYLMKNSGRILNVTQILSKVWGYDYEGESNLVAVYIRRLRTKVEEDPDHPRHVITVRNLGYKFEP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-28 41
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 3e-28 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Chy400_1981 YP_002569712.1 winged helix family two component transcriptional regulator AF155139.2.orf0.gene Protein 7e-36 43
Chy400_1981 YP_002569712.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 8e-40 43
Chy400_1981 YP_002569712.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 9e-40 43
Chy400_1981 YP_002569712.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 7e-40 43
Chy400_1981 YP_002569712.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 9e-40 43
Chy400_1981 YP_002569712.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 9e-40 43
Chy400_1981 YP_002569712.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 9e-40 43
Chy400_1981 YP_002569712.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 9e-40 43
Chy400_1981 YP_002569712.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 9e-40 43
Chy400_1981 YP_002569712.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 9e-40 43
Chy400_1981 YP_002569712.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 9e-40 43
Chy400_1981 YP_002569712.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 2e-37 42
Chy400_1981 YP_002569712.1 winged helix family two component transcriptional regulator BAC0125 Protein 2e-33 41
Chy400_1981 YP_002569712.1 winged helix family two component transcriptional regulator BAC0197 Protein 4e-29 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Chy400_1981 YP_002569712.1 winged helix family two component transcriptional regulator VFG1390 Protein 2e-32 45
Chy400_1981 YP_002569712.1 winged helix family two component transcriptional regulator VFG0596 Protein 4e-29 41