Gene Information

Name : Chy400_2626 (Chy400_2626)
Accession : YP_002570344.1
Strain : Chloroflexus sp. Y-400-fl
Genome accession: NC_012032
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 3263409 - 3264125 bp
Length : 717 bp
Strand : -
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: cau:Caur_2437 response regulator receiver

DNA sequence :
ATGAAATCAACAGAAACTGATCGCGAATTACACATTCTGGTTATCGAAGATGAGCCAACCATCGCCGAATCCCTCCGCGT
TGGCTTAACGTATGAAGGTATGCGGGTCACTGTGACAACCGAAGGGCGGAGCGGTTTACAAGTGAGCGAAGAGCAAGAGG
TTGATCTGGTCATCCTTGATCTGATGCTCCCCGACATCGACGGCATGGTTGTTTGTCGGCGCCTGCGCGCTCGTTCCAGC
ACGCTACCCATCATCATGCTGACGGCCCGTGGTGAGGTGCAAGAGCGGGTACAGGGGTTACAATTAGGAGCCGACGATTA
TATCGTCAAGCCATTTAGCTTCGATGAATTATTAGCCCGCGTCTACGCTGTCTTGCGGCGAGCTGGTGTCAGTCGGCCAT
CAACCGTGCTGCGGATTGCCGGTCTCACCCTCGACACCGAAACCCGGGAAGTGACGCTTAATGGCCGGCAATTAGAGTTG
ACCCCCACCGAATTCGCACTCCTTGAGCTATTCATGCGCCATCCCCGTCGGGTATTTACCAGAGAGACCCTGCTCAGTCG
GGTATGGGGGTTCACGTATGTCGGCGACTCAAACATCGTTGAAGTACATATGAGCAATCTACGTGAAAAGATAGGTGATC
ATGAGCGCAAACTCATCCGTACCATCTATGGCGTCGGCTACTGTTTACGGCCTGAAGATGAAACAGCAGTGGCATAG

Protein sequence :
MKSTETDRELHILVIEDEPTIAESLRVGLTYEGMRVTVTTEGRSGLQVSEEQEVDLVILDLMLPDIDGMVVCRRLRARSS
TLPIIMLTARGEVQERVQGLQLGADDYIVKPFSFDELLARVYAVLRRAGVSRPSTVLRIAGLTLDTETREVTLNGRQLEL
TPTEFALLELFMRHPRRVFTRETLLSRVWGFTYVGDSNIVEVHMSNLREKIGDHERKLIRTIYGVGYCLRPEDETAVA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 6e-36 44
ef0091 AAM75294.1 EF0091 Not tested Not named Protein 1e-32 43
EF0571 NP_814337.1 DNA-binding response regulator Not tested Not named Protein 1e-32 43
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 3e-35 43
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 3e-38 42
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 4e-37 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Chy400_2626 YP_002570344.1 winged helix family two component transcriptional regulator BAC0197 Protein 5e-42 49
Chy400_2626 YP_002570344.1 winged helix family two component transcriptional regulator BAC0125 Protein 6e-42 46
Chy400_2626 YP_002570344.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 2e-36 46
Chy400_2626 YP_002570344.1 winged helix family two component transcriptional regulator BAC0083 Protein 6e-40 44
Chy400_2626 YP_002570344.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 7e-41 43
Chy400_2626 YP_002570344.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 7e-41 43
Chy400_2626 YP_002570344.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 7e-41 43
Chy400_2626 YP_002570344.1 winged helix family two component transcriptional regulator AE015929.1.gene1106. Protein 1e-36 43
Chy400_2626 YP_002570344.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 7e-41 43
Chy400_2626 YP_002570344.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 7e-41 43
Chy400_2626 YP_002570344.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 7e-41 43
Chy400_2626 YP_002570344.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 7e-41 43
Chy400_2626 YP_002570344.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 7e-41 43
Chy400_2626 YP_002570344.1 winged helix family two component transcriptional regulator BAC0638 Protein 1e-35 43
Chy400_2626 YP_002570344.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 2e-39 43
Chy400_2626 YP_002570344.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 1e-39 43
Chy400_2626 YP_002570344.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 2e-39 43
Chy400_2626 YP_002570344.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 2e-39 43
Chy400_2626 YP_002570344.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 2e-39 43
Chy400_2626 YP_002570344.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 1e-39 43
Chy400_2626 YP_002570344.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 2e-39 43
Chy400_2626 YP_002570344.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 2e-39 43
Chy400_2626 YP_002570344.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 2e-39 43
Chy400_2626 YP_002570344.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 2e-39 43
Chy400_2626 YP_002570344.1 winged helix family two component transcriptional regulator BAC0347 Protein 1e-38 43
Chy400_2626 YP_002570344.1 winged helix family two component transcriptional regulator BAC0111 Protein 6e-42 43
Chy400_2626 YP_002570344.1 winged helix family two component transcriptional regulator BAC0308 Protein 2e-36 42
Chy400_2626 YP_002570344.1 winged helix family two component transcriptional regulator HE999704.1.gene1528. Protein 4e-33 41
Chy400_2626 YP_002570344.1 winged helix family two component transcriptional regulator FJ349556.1.orf0.gene Protein 7e-39 41
Chy400_2626 YP_002570344.1 winged helix family two component transcriptional regulator AF155139.2.orf0.gene Protein 3e-40 41
Chy400_2626 YP_002570344.1 winged helix family two component transcriptional regulator NC_012469.1.7686381. Protein 2e-40 41
Chy400_2626 YP_002570344.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 1e-40 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Chy400_2626 YP_002570344.1 winged helix family two component transcriptional regulator VFG1390 Protein 2e-46 46
Chy400_2626 YP_002570344.1 winged helix family two component transcriptional regulator VFG0596 Protein 2e-36 44
Chy400_2626 YP_002570344.1 winged helix family two component transcriptional regulator VFG1386 Protein 8e-42 43
Chy400_2626 YP_002570344.1 winged helix family two component transcriptional regulator VFG1563 Protein 2e-38 42
Chy400_2626 YP_002570344.1 winged helix family two component transcriptional regulator VFG1702 Protein 2e-37 41