Gene Information

Name : Chy400_3655 (Chy400_3655)
Accession : YP_002571349.1
Strain : Chloroflexus sp. Y-400-fl
Genome accession: NC_012032
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 4553798 - 4554502 bp
Length : 705 bp
Strand : +
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: cau:Caur_3391 response regulator receiver

DNA sequence :
ATGGAAGCAGCTACAATTCTCGTTGTTGATGACGAGCAACCAATTGTTGATCTGGTCAGCAGTTACCTGACAAACGAGGG
TTTTGTTGTGCATCGGGCTTACGATGGCCCTGGCGCGTTGGCGCTGGCGCGGAGTGTGAAGCCCGATCTGGTTGTTCTTG
ATGTGATGCTGCCGGGGCTGGACGGGATTGAGGTTTGTCGGCAGTTGCACCGCGACACCTCGGTGTTTGTACTGATGCTG
ACGGCACGCGCCGATGAGATTGATAAGCTGATCGGTTTGTCGGTCGGTGCTGATGATTATCTGACCAAGCCATTCAGTCC
GCGTGAGTTGGTCGCACGGGTGAAGGCTATTCTCCGCCGTAATCGGGTTATTCGTGCGATAGAGGTGAACCAGCGCCCGA
TTTTGCAATTTGAAGGGCTGTTGATCGACCCCGAACGGCGCGAAGTTGAACGCAACGGGGTGCGGGTTGATTTGACCCCG
CGTGAATTTGATCTGCTCTATGCACTGGCCAGCTATCCGGGGCGCGTGTTCACCCGTGAAGAGTTGCTTCAGCGTGTGTG
GGGGCCAGATTTTGCCGGTATTGATCGGGTGGTTGACGTGCATATCGGTACTCTGCGGCGCAAGCTCGATGATGATCATC
ACGGCACGCCTCTGGTGCAGACGGTTCGTGGCGTTGGTTATAAGTTTGTTGGTAGTACGCGATGA

Protein sequence :
MEAATILVVDDEQPIVDLVSSYLTNEGFVVHRAYDGPGALALARSVKPDLVVLDVMLPGLDGIEVCRQLHRDTSVFVLML
TARADEIDKLIGLSVGADDYLTKPFSPRELVARVKAILRRNRVIRAIEVNQRPILQFEGLLIDPERREVERNGVRVDLTP
REFDLLYALASYPGRVFTREELLQRVWGPDFAGIDRVVDVHIGTLRRKLDDDHHGTPLVQTVRGVGYKFVGSTR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 4e-28 42
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 3e-35 41
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 2e-27 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Chy400_3655 YP_002571349.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 2e-46 49
Chy400_3655 YP_002571349.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 2e-46 49
Chy400_3655 YP_002571349.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 2e-46 49
Chy400_3655 YP_002571349.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 2e-46 49
Chy400_3655 YP_002571349.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 2e-46 49
Chy400_3655 YP_002571349.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 2e-46 49
Chy400_3655 YP_002571349.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 2e-46 49
Chy400_3655 YP_002571349.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 2e-46 49
Chy400_3655 YP_002571349.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 9e-44 49
Chy400_3655 YP_002571349.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 2e-46 48
Chy400_3655 YP_002571349.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 2e-46 48
Chy400_3655 YP_002571349.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 3e-37 48
Chy400_3655 YP_002571349.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 4e-42 47
Chy400_3655 YP_002571349.1 winged helix family two component transcriptional regulator NC_012469.1.7686381. Protein 6e-44 46
Chy400_3655 YP_002571349.1 winged helix family two component transcriptional regulator CP000675.2.gene1535. Protein 4e-41 45
Chy400_3655 YP_002571349.1 winged helix family two component transcriptional regulator AF155139.2.orf0.gene Protein 3e-46 44
Chy400_3655 YP_002571349.1 winged helix family two component transcriptional regulator CP004022.1.gene3215. Protein 1e-36 44
Chy400_3655 YP_002571349.1 winged helix family two component transcriptional regulator AE016830.1.gene1681. Protein 9e-41 44
Chy400_3655 YP_002571349.1 winged helix family two component transcriptional regulator CP001918.1.gene5135. Protein 2e-29 44
Chy400_3655 YP_002571349.1 winged helix family two component transcriptional regulator CP001138.1.gene4273. Protein 3e-32 43
Chy400_3655 YP_002571349.1 winged helix family two component transcriptional regulator BAC0533 Protein 9e-33 43
Chy400_3655 YP_002571349.1 winged helix family two component transcriptional regulator FJ349556.1.orf0.gene Protein 5e-45 43
Chy400_3655 YP_002571349.1 winged helix family two component transcriptional regulator NC_002695.1.915041.p Protein 7e-33 43
Chy400_3655 YP_002571349.1 winged helix family two component transcriptional regulator CP000647.1.gene4257. Protein 9e-33 43
Chy400_3655 YP_002571349.1 winged helix family two component transcriptional regulator CP000034.1.gene3834. Protein 7e-33 43
Chy400_3655 YP_002571349.1 winged helix family two component transcriptional regulator AF162694.1.orf4.gene Protein 1e-35 43
Chy400_3655 YP_002571349.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 1e-34 42
Chy400_3655 YP_002571349.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 1e-34 42
Chy400_3655 YP_002571349.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 1e-34 42
Chy400_3655 YP_002571349.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 1e-34 42
Chy400_3655 YP_002571349.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 1e-34 42
Chy400_3655 YP_002571349.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 1e-34 42
Chy400_3655 YP_002571349.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 1e-34 42
Chy400_3655 YP_002571349.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 1e-34 42
Chy400_3655 YP_002571349.1 winged helix family two component transcriptional regulator AF130997.1.orf0.gene Protein 2e-36 42
Chy400_3655 YP_002571349.1 winged helix family two component transcriptional regulator AM180355.1.gene1830. Protein 7e-40 42
Chy400_3655 YP_002571349.1 winged helix family two component transcriptional regulator DQ212986.1.gene4.p01 Protein 1e-39 42
Chy400_3655 YP_002571349.1 winged helix family two component transcriptional regulator BAC0197 Protein 3e-28 42
Chy400_3655 YP_002571349.1 winged helix family two component transcriptional regulator CP001485.1.gene721.p Protein 3e-33 41
Chy400_3655 YP_002571349.1 winged helix family two component transcriptional regulator CP000647.1.gene2531. Protein 3e-38 41
Chy400_3655 YP_002571349.1 winged helix family two component transcriptional regulator CP001918.1.gene3444. Protein 2e-38 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Chy400_3655 YP_002571349.1 winged helix family two component transcriptional regulator VFG1389 Protein 6e-29 48
Chy400_3655 YP_002571349.1 winged helix family two component transcriptional regulator VFG1390 Protein 9e-37 44
Chy400_3655 YP_002571349.1 winged helix family two component transcriptional regulator VFG1386 Protein 2e-31 44
Chy400_3655 YP_002571349.1 winged helix family two component transcriptional regulator VFG0596 Protein 2e-28 42
Chy400_3655 YP_002571349.1 winged helix family two component transcriptional regulator VFG1563 Protein 2e-35 41