Gene Information

Name : Athe_1456 (Athe_1456)
Accession : YP_002573327.1
Strain : Caldicellulosiruptor bescii DSM 6725
Genome accession: NC_012034
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1542256 - 1542927 bp
Length : 672 bp
Strand : -
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receiver; KEGG: csc:Csac_2003 two component transcriptional regulator

DNA sequence :
ATGAAAATCCTTATCATTGATGATGATGTAAAGATATGTGAGGTAATAAAACTTTACTTAGAAAAAGAAGGATTTGAAGT
AGTAGTTGCTCACAATGGTATGGATGGAATTGCTATGTTCAAAAATGAAATGCCCGACCTGGTAATACTGGACATTATGC
TGCCCAAAAAAGATGGATATGAAGTCTGTAGAGAACTCAGAAAAATTAGTAACATTCCAATTATAATGCTTACTGCAAAG
GGCGAGACATTTGATAAGGTACTTGGATTAGAGTTGGGAGCAGATGACTACATTGTAAAACCGTTTGATCCAAAAGAACT
AATTGCACGAATAAAAGCAGTACTGCGAAGAACACAGGGTGAAGTCAATGATGAAAAGGTTGTTGTATATCCAAATCTAA
CAGTAAATCTCACTACATATGAGGTAAAACTTGAAGATAAAGTAATAGATATGCCGCCGAAAGAGATAGAGCTTTTGTAT
TTCTTAGCATCACATCCCAACAAGGTGTTCACAAGAGAGCAACTTCTTGACCATATATGGGGTTACAACTTTGTTGGAGA
CACTCGTACAGTTGATGTACACATCAAGAGAATAAGAGAAAAGATTGAAAAGGACAAATATCCTTGGAAGATAAAGACTG
TATGGGGTGTAGGTTATAAGTTTGAAATTTAG

Protein sequence :
MKILIIDDDVKICEVIKLYLEKEGFEVVVAHNGMDGIAMFKNEMPDLVILDIMLPKKDGYEVCRELRKISNIPIIMLTAK
GETFDKVLGLELGADDYIVKPFDPKELIARIKAVLRRTQGEVNDEKVVVYPNLTVNLTTYEVKLEDKVIDMPPKEIELLY
FLASHPNKVFTREQLLDHIWGYNFVGDTRTVDVHIKRIREKIEKDKYPWKIKTVWGVGYKFEI

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 7e-37 42
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 1e-36 42
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 2e-24 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Athe_1456 YP_002573327.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 1e-49 51
Athe_1456 YP_002573327.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 9e-45 50
Athe_1456 YP_002573327.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 3e-47 48
Athe_1456 YP_002573327.1 winged helix family two component transcriptional regulator NC_012469.1.7686381. Protein 9e-42 48
Athe_1456 YP_002573327.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 2e-47 48
Athe_1456 YP_002573327.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 3e-47 48
Athe_1456 YP_002573327.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 3e-47 48
Athe_1456 YP_002573327.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 3e-47 48
Athe_1456 YP_002573327.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 3e-47 48
Athe_1456 YP_002573327.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 3e-47 48
Athe_1456 YP_002573327.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 2e-47 48
Athe_1456 YP_002573327.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 3e-47 48
Athe_1456 YP_002573327.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 3e-47 48
Athe_1456 YP_002573327.1 winged helix family two component transcriptional regulator AF155139.2.orf0.gene Protein 1e-41 46
Athe_1456 YP_002573327.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 6e-38 46
Athe_1456 YP_002573327.1 winged helix family two component transcriptional regulator FJ349556.1.orf0.gene Protein 3e-42 44
Athe_1456 YP_002573327.1 winged helix family two component transcriptional regulator AE015929.1.gene1106. Protein 8e-32 43
Athe_1456 YP_002573327.1 winged helix family two component transcriptional regulator BAC0347 Protein 2e-27 42
Athe_1456 YP_002573327.1 winged helix family two component transcriptional regulator DQ212986.1.gene4.p01 Protein 8e-35 42
Athe_1456 YP_002573327.1 winged helix family two component transcriptional regulator EU250284.1.orf4.gene Protein 1e-33 42
Athe_1456 YP_002573327.1 winged helix family two component transcriptional regulator CP000034.1.gene3671. Protein 7e-37 42
Athe_1456 YP_002573327.1 winged helix family two component transcriptional regulator CP004022.1.gene1676. Protein 5e-33 42
Athe_1456 YP_002573327.1 winged helix family two component transcriptional regulator BAC0111 Protein 1e-29 41
Athe_1456 YP_002573327.1 winged helix family two component transcriptional regulator AM180355.1.gene1830. Protein 8e-33 41
Athe_1456 YP_002573327.1 winged helix family two component transcriptional regulator AE016830.1.gene1681. Protein 1e-37 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Athe_1456 YP_002573327.1 winged helix family two component transcriptional regulator VFG1563 Protein 4e-37 42
Athe_1456 YP_002573327.1 winged helix family two component transcriptional regulator VFG1702 Protein 4e-37 42