Gene Information

Name : SEQ_1577 (SEQ_1577)
Accession : YP_002746832.1
Strain : Streptococcus equi 4047
Genome accession: NC_012471
Putative virulence/resistance : Virulence
Product : response regulator protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1581624 - 1582334 bp
Length : 711 bp
Strand : -
Note : -

DNA sequence :
ATGAAGAAAATACTGATTGTTGATGATGAAAAGCCGATTTCTGATATCATTAAATTTAATCTGACAAAGGAAGGCTATGA
TACGGTCACAGCATTTGATGGCAAAGAGGCCGTTGCAGTCTTTGAAGAGGAAAAGCCAGATTTGATTATTTTGGATTTGA
TGCTTCCTGAATTAGATGGCCTTGAGGTAGCCAAGGAAATCCGCAAGACCAGCCATATTCCTATCATCATGCTATCTGCT
AAGGATAGCGAATTTGATAAGGTGATTGGACTTGAAATAGGGGCCGATGATTATGTGACTAAGCCCTTTTCAAATCGTGA
GCTGCTGGCGCGTGTCAAGGCACATTTGCGTCGGACAGAGACTATTGAGACAGCAGTAGCCGAAGAAAATGCCTCCTCAG
GCTCTCAGGAGCTAACCATCGGCAATCTACAGATTTTACCAGATGCCTTTATCGCTAAAAAGCATGGTCAAGAGGTTGAG
CTGACCCATCGTGAGTTTGAATTGCTGCATCATCTGGCAAACCATATCGGACAGGTCATGACACGTGAGCATTTGCTTGA
GACCGTATGGGGCTACGATTATTTTGGCGATGTTCGAACCGTTGACGTTACTATCCGTCGCCTGCGCGAAAAAATAGAGG
ATACACCGAGTCGTCCAGAGTATATTTTGACAAGACGTGGTGTTGGGTACTACATGAAGGCTTATGACTAA

Protein sequence :
MKKILIVDDEKPISDIIKFNLTKEGYDTVTAFDGKEAVAVFEEEKPDLIILDLMLPELDGLEVAKEIRKTSHIPIIMLSA
KDSEFDKVIGLEIGADDYVTKPFSNRELLARVKAHLRRTETIETAVAEENASSGSQELTIGNLQILPDAFIAKKHGQEVE
LTHREFELLHHLANHIGQVMTREHLLETVWGYDYFGDVRTVDVTIRRLREKIEDTPSRPEYILTRRGVGYYMKAYD

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 5e-39 42
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 8e-39 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SEQ_1577 YP_002746832.1 response regulator protein NC_012469.1.7685629. Protein 3e-89 78
SEQ_1577 YP_002746832.1 response regulator protein HE999704.1.gene2815. Protein 8e-55 53
SEQ_1577 YP_002746832.1 response regulator protein NC_002952.2859905.p0 Protein 6e-55 52
SEQ_1577 YP_002746832.1 response regulator protein NC_007622.3794472.p0 Protein 6e-55 52
SEQ_1577 YP_002746832.1 response regulator protein NC_002745.1124361.p0 Protein 8e-55 52
SEQ_1577 YP_002746832.1 response regulator protein NC_003923.1003749.p0 Protein 5e-55 52
SEQ_1577 YP_002746832.1 response regulator protein NC_009782.5559369.p0 Protein 8e-55 52
SEQ_1577 YP_002746832.1 response regulator protein NC_002951.3237708.p0 Protein 8e-55 52
SEQ_1577 YP_002746832.1 response regulator protein NC_002758.1121668.p0 Protein 8e-55 52
SEQ_1577 YP_002746832.1 response regulator protein NC_009641.5332272.p0 Protein 8e-55 52
SEQ_1577 YP_002746832.1 response regulator protein NC_013450.8614421.p0 Protein 8e-55 52
SEQ_1577 YP_002746832.1 response regulator protein NC_007793.3914279.p0 Protein 8e-55 52
SEQ_1577 YP_002746832.1 response regulator protein NC_012469.1.7686381. Protein 2e-47 49
SEQ_1577 YP_002746832.1 response regulator protein AE016830.1.gene1681. Protein 2e-48 48
SEQ_1577 YP_002746832.1 response regulator protein FJ349556.1.orf0.gene Protein 2e-42 45
SEQ_1577 YP_002746832.1 response regulator protein AF155139.2.orf0.gene Protein 7e-42 44
SEQ_1577 YP_002746832.1 response regulator protein AF162694.1.orf4.gene Protein 6e-38 43
SEQ_1577 YP_002746832.1 response regulator protein AM180355.1.gene1830. Protein 6e-41 43
SEQ_1577 YP_002746832.1 response regulator protein DQ212986.1.gene4.p01 Protein 1e-40 43
SEQ_1577 YP_002746832.1 response regulator protein AE015929.1.gene1106. Protein 2e-33 42
SEQ_1577 YP_002746832.1 response regulator protein CP000034.1.gene3834. Protein 1e-32 42
SEQ_1577 YP_002746832.1 response regulator protein BAC0533 Protein 4e-33 42
SEQ_1577 YP_002746832.1 response regulator protein NC_002695.1.915041.p Protein 1e-32 42
SEQ_1577 YP_002746832.1 response regulator protein CP000647.1.gene4257. Protein 4e-33 42
SEQ_1577 YP_002746832.1 response regulator protein NC_005054.2598277.p0 Protein 3e-40 42
SEQ_1577 YP_002746832.1 response regulator protein NC_014475.1.orf0.gen Protein 3e-40 42
SEQ_1577 YP_002746832.1 response regulator protein NC_002758.1121390.p0 Protein 4e-37 41
SEQ_1577 YP_002746832.1 response regulator protein NC_010079.5776364.p0 Protein 4e-37 41
SEQ_1577 YP_002746832.1 response regulator protein NC_002952.2859858.p0 Protein 4e-37 41
SEQ_1577 YP_002746832.1 response regulator protein NC_007622.3794948.p0 Protein 4e-37 41
SEQ_1577 YP_002746832.1 response regulator protein NC_003923.1003417.p0 Protein 4e-37 41
SEQ_1577 YP_002746832.1 response regulator protein NC_013450.8614146.p0 Protein 4e-37 41
SEQ_1577 YP_002746832.1 response regulator protein NC_002951.3238224.p0 Protein 4e-37 41
SEQ_1577 YP_002746832.1 response regulator protein NC_007793.3914065.p0 Protein 4e-37 41
SEQ_1577 YP_002746832.1 response regulator protein CP001138.1.gene4273. Protein 1e-32 41
SEQ_1577 YP_002746832.1 response regulator protein CP004022.1.gene3215. Protein 3e-35 41
SEQ_1577 YP_002746832.1 response regulator protein CP001918.1.gene5135. Protein 9e-28 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SEQ_1577 YP_002746832.1 response regulator protein VFG1389 Protein 7e-35 43
SEQ_1577 YP_002746832.1 response regulator protein VFG1563 Protein 3e-39 42
SEQ_1577 YP_002746832.1 response regulator protein VFG1702 Protein 3e-39 41