
|
Name : rpsN (Lm4b_01898) Accession : YP_002758592.1 Strain : Listeria monocytogenes Clip81459 Genome accession: NC_012488 Putative virulence/resistance : Unknown Product : 30S ribosomal protein S14 Function : - COG functional category : J : Translation, ribosomal structure and biogenesis COG ID : COG0199 EC number : - Position : 1943070 - 1943339 bp Length : 270 bp Strand : - Note : located in the peptidyl transferase center and involved in assembly of 30S ribosome subunit; similar to what is observed with proteins L31 and L33, some proteins in this family contain CXXC motifs that are involved in zinc binding; if two copies are prese DNA sequence : ATGGCTAAAGAATCAAAAGTTGCCAAACATGAACGTCAACAAGCGCTCGTGGAAAAATATGCGGAACTTCGCCGAACGCT AAAAGCAGAAGGCCGCTACGATGAATTACGCAAATTACCACGCGATTCTTCCCCGTCCCGGCTACACAATCGTTGTGAAC TAACTGGACGTCCCCACGGCTACATGCGTAAATTTGGTATGTCGCGGATTCGTTTTCGTGAACTAGCACATCAAGGACAA TTACCCGGCGTGACAAAAGCAAGCTGGTAA Protein sequence : MAKESKVAKHERQQALVEKYAELRRTLKAEGRYDELRKLPRDSSPSRLHNRCELTGRPHGYMRKFGMSRIRFRELAHQGQ LPGVTKASW |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| ef0103 | AAM75306.1 | EF0103 | Not tested | Not named | Protein | 5e-20 | 67 |
| rpsN | NP_814350.1 | 30S ribosomal protein S14 | Not tested | Not named | Protein | 7e-20 | 67 |