Gene Information

Name : GAU_2013 (GAU_2013)
Accession : YP_002761525.1
Strain : Gemmatimonas aurantiaca T-27
Genome accession: NC_012489
Putative virulence/resistance : Resistance
Product : OmpR family two-component response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2344176 - 2344844 bp
Length : 669 bp
Strand : -
Note : -

DNA sequence :
ATGAAGATCCTGGTGATCGAAGACGATCCCACGGTAGGGGAGTTCGTACGACGTGGTCTCGAGGAGCAGCGCTGGCAGAC
TGACCTGTGCAACAATGGGCTCGAAGGCGAGCGCATGGCGCTGTCACAGCCGTATGATCTGGTCATCCTCGATATGCGCC
TGCCCGGACGCAACGGGCTCGACGTCCTGCGCACGCTGCGGTCGAGTGGCTTCGAGCGGCCCGTGCTGGTGCTGACCGCG
CAGGACGCGGTGGATGCCAAGGTCGAGACGCTGCGCGCCGGGGCTGACGACTATGTGACCAAGCCGTTTGCTTTCGAGGA
GTTGCTCGCCCGCGCCGAGGCGTTGCTGCGCCGGCCGCGCGCGCTGGCCTCACCGCAACTGCGGGTGGGTGATCTCGAAC
TCGATCAGGGCACACGCGAGGTGCTTCGCGCGGGCGAACTCATCGAGCTGACGCCGAAGGAGTTTGCGGTGCTCGAGTAC
CTCATGCGCCATGCGGGCCGCGTCATGAGCCGTACGCTGATCACCGAGTACGCCTGGGGGTACCACTTCGATCCGGGCAC
CAACATCGTGGACGTGGTGATCAATCACTTGCGCAAGAAGATCGATGCGCGTTTCGACAAGAAGCTCATCACGACGGTGC
GTGGCGTCGGTTACATGATCCGGAGCTGA

Protein sequence :
MKILVIEDDPTVGEFVRRGLEEQRWQTDLCNNGLEGERMALSQPYDLVILDMRLPGRNGLDVLRTLRSSGFERPVLVLTA
QDAVDAKVETLRAGADDYVTKPFAFEELLARAEALLRRPRALASPQLRVGDLELDQGTREVLRAGELIELTPKEFAVLEY
LMRHAGRVMSRTLITEYAWGYHFDPGTNIVDVVINHLRKKIDARFDKKLITTVRGVGYMIRS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 4e-33 46
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 2e-32 46
vanRB NP_815956.1 DNA-binding response regulator VanRB Not tested Not named Protein 4e-25 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
GAU_2013 YP_002761525.1 OmpR family two-component response regulator BAC0125 Protein 1e-36 49
GAU_2013 YP_002761525.1 OmpR family two-component response regulator BAC0308 Protein 4e-34 47
GAU_2013 YP_002761525.1 OmpR family two-component response regulator BAC0197 Protein 5e-36 47
GAU_2013 YP_002761525.1 OmpR family two-component response regulator BAC0347 Protein 2e-37 46
GAU_2013 YP_002761525.1 OmpR family two-component response regulator BAC0111 Protein 8e-40 46
GAU_2013 YP_002761525.1 OmpR family two-component response regulator BAC0083 Protein 4e-36 45
GAU_2013 YP_002761525.1 OmpR family two-component response regulator BAC0638 Protein 5e-30 44
GAU_2013 YP_002761525.1 OmpR family two-component response regulator U35369.1.gene1.p01 Protein 2e-25 41
GAU_2013 YP_002761525.1 OmpR family two-component response regulator AE016830.1.gene2255. Protein 2e-25 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
GAU_2013 YP_002761525.1 OmpR family two-component response regulator VFG0596 Protein 2e-33 46
GAU_2013 YP_002761525.1 OmpR family two-component response regulator VFG1390 Protein 2e-30 46