Gene Information

Name : RER_05950 (RER_05950)
Accession : YP_002764042.1
Strain : Rhodococcus erythropolis PR4
Genome accession: NC_012490
Putative virulence/resistance : Resistance
Product : putative tellurium resistance protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG2310
EC number : -
Position : 673344 - 673919 bp
Length : 576 bp
Strand : -
Note : -

DNA sequence :
ATGGGCGTCAGCTTGACCAAAGGCGGCAATGTCTCTCTCACGAAGGAGGCCCCGAACCTGACTGCAGTGGTCGTCGGCCT
GGGCTGGGACGCGCGTTCCACCACCGGAGCTGCTTTCGACCTCGACGCCAGCGCAATCGGCGCAGGCTCGAACAAGAAGG
TCCTCTCCGACCAGCACTTCATCTTCTTCAACAACCTCCGCTCGCCCGACGGCTCAATCGAGCACAAGGGTGACAACACG
GACGGCGAAGGCGAAGGCGACGACGAGCAGATCGACGTGAACCTCGCTGCGGTTCCCGCCGAGATCGAAAGCGTTGTCTT
CCCCGTCTCGATCTACGACGCAGAGGCTCGCTCGCAGTCCTTCGGCCAGGTCCGCAACGCGTACATCCGCGTCGTCGACA
AGGCGAACGGCAACGAGCTCGCTCGCTACGACCTCTCCGAGGACGCTTCCACCGAAACCGCCATGGTCTTCGGTGAGCTG
TACCGCAACGGTGCAGAGTGGAAGTTCCGCGCAATCGGCCAGGGTTACGCATCCGGCCTGTCCGGCATCGCGCGCGATTA
CGGCGTCAACGTCTGA

Protein sequence :
MGVSLTKGGNVSLTKEAPNLTAVVVGLGWDARSTTGAAFDLDASAIGAGSNKKVLSDQHFIFFNNLRSPDGSIEHKGDNT
DGEGEGDDEQIDVNLAAVPAEIESVVFPVSIYDAEARSQSFGQVRNAYIRVVDKANGNELARYDLSEDASTETAMVFGEL
YRNGAEWKFRAIGQGYASGLSGIARDYGVNV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-56 66
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-56 66
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 2e-56 66
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 1e-53 65
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 1e-52 63
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 4e-53 63
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 4e-53 63
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 3e-54 61
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 4e-26 42
terZ NP_286706.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-21 41
terZ_2 NP_287114.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-21 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
RER_05950 YP_002764042.1 putative tellurium resistance protein BAC0390 Protein 1e-55 61
RER_05950 YP_002764042.1 putative tellurium resistance protein BAC0389 Protein 1e-52 61
RER_05950 YP_002764042.1 putative tellurium resistance protein BAC0392 Protein 7e-22 41