Gene Information

Name : BBR47_28050 (BBR47_28050)
Accession : YP_002772286.1
Strain : Brevibacillus brevis NBRC 100599
Genome accession: NC_012491
Putative virulence/resistance : Virulence
Product : two-component response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2925016 - 2925711 bp
Length : 696 bp
Strand : +
Note : -

DNA sequence :
ATGATATGCATGCCTACGCCAGATGGAAAAGGTTATTTGCTGCTTGTTGAAGATGAACATAACTTGGCAAGATACTTACA
ATTGGAGTTGGAGAATGAAGGATTTTCGACGGATATTGAATACGACGGGCTTTCCGGATTAGAAAAGGCACTGACGATCG
AGTACGACCTCATCCTGCTGGATGTCATGCTGCCCGAATTATCGGGGATAGAATTATGCCGGCGCATTCGGGAAACCAAA
GATGTCCCCATTATCATGATCACGGCTCGCGGAGAGGTTCCGGATATCGTGACGGGATTAGACAGTGGAGCAAATGACTA
CTTGGCAAAGCCGTTTGCCATCGAGGAGTTGTTTGCCCGGATTCGAGTCTTATTGCGTCAGCGGGAATCAAAAGCAAACC
AGGAGATAGTGGTTGGCCGATTGCGTATCCAGCCCAACGCGCGGCGAGTGTTCCTCGATGAAGAGGAAATCATGTTGACC
CCACGCGAGTTTGATTTGCTTTATTATATGGTTCAAAACAAGGAGCAAGCGGTTTCGCGAGAGCAAATTCTCACAGCCGT
TTGGGGTTTTGACTTTATGGGGAATACCAACATCGTGGATGTGTATATCCGGTATTTGCGGAACAAAATTGAAAGTGATC
CATCCGTCAAGCTGATACATACCGTCCGAGGAATCGGCTATACACTACGAGATTAA

Protein sequence :
MICMPTPDGKGYLLLVEDEHNLARYLQLELENEGFSTDIEYDGLSGLEKALTIEYDLILLDVMLPELSGIELCRRIRETK
DVPIIMITARGEVPDIVTGLDSGANDYLAKPFAIEELFARIRVLLRQRESKANQEIVVGRLRIQPNARRVFLDEEEIMLT
PREFDLLYYMVQNKEQAVSREQILTAVWGFDFMGNTNIVDVYIRYLRNKIESDPSVKLIHTVRGIGYTLRD

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-35 41
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 3e-34 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BBR47_28050 YP_002772286.1 two-component response regulator NC_002758.1121390.p0 Protein 1e-53 53
BBR47_28050 YP_002772286.1 two-component response regulator NC_010079.5776364.p0 Protein 1e-53 53
BBR47_28050 YP_002772286.1 two-component response regulator NC_002952.2859858.p0 Protein 1e-53 53
BBR47_28050 YP_002772286.1 two-component response regulator NC_007622.3794948.p0 Protein 1e-53 53
BBR47_28050 YP_002772286.1 two-component response regulator NC_003923.1003417.p0 Protein 1e-53 53
BBR47_28050 YP_002772286.1 two-component response regulator NC_013450.8614146.p0 Protein 1e-53 53
BBR47_28050 YP_002772286.1 two-component response regulator NC_002951.3238224.p0 Protein 1e-53 53
BBR47_28050 YP_002772286.1 two-component response regulator NC_007793.3914065.p0 Protein 1e-53 53
BBR47_28050 YP_002772286.1 two-component response regulator AE015929.1.gene1106. Protein 5e-47 50
BBR47_28050 YP_002772286.1 two-component response regulator HE999704.1.gene1528. Protein 2e-44 49
BBR47_28050 YP_002772286.1 two-component response regulator BAC0125 Protein 3e-41 46
BBR47_28050 YP_002772286.1 two-component response regulator BAC0083 Protein 1e-38 43
BBR47_28050 YP_002772286.1 two-component response regulator BAC0308 Protein 7e-37 43
BBR47_28050 YP_002772286.1 two-component response regulator BAC0111 Protein 4e-39 42
BBR47_28050 YP_002772286.1 two-component response regulator HE999704.1.gene2815. Protein 3e-41 42
BBR47_28050 YP_002772286.1 two-component response regulator BAC0638 Protein 2e-34 42
BBR47_28050 YP_002772286.1 two-component response regulator NC_002952.2859905.p0 Protein 8e-44 41
BBR47_28050 YP_002772286.1 two-component response regulator NC_009782.5559369.p0 Protein 5e-44 41
BBR47_28050 YP_002772286.1 two-component response regulator NC_002951.3237708.p0 Protein 5e-44 41
BBR47_28050 YP_002772286.1 two-component response regulator NC_003923.1003749.p0 Protein 4e-44 41
BBR47_28050 YP_002772286.1 two-component response regulator NC_002758.1121668.p0 Protein 5e-44 41
BBR47_28050 YP_002772286.1 two-component response regulator NC_009641.5332272.p0 Protein 5e-44 41
BBR47_28050 YP_002772286.1 two-component response regulator NC_013450.8614421.p0 Protein 5e-44 41
BBR47_28050 YP_002772286.1 two-component response regulator NC_007793.3914279.p0 Protein 5e-44 41
BBR47_28050 YP_002772286.1 two-component response regulator NC_007622.3794472.p0 Protein 7e-44 41
BBR47_28050 YP_002772286.1 two-component response regulator NC_002745.1124361.p0 Protein 5e-44 41
BBR47_28050 YP_002772286.1 two-component response regulator BAC0197 Protein 5e-39 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BBR47_28050 YP_002772286.1 two-component response regulator VFG1390 Protein 2e-43 43
BBR47_28050 YP_002772286.1 two-component response regulator VFG1389 Protein 7e-40 43
BBR47_28050 YP_002772286.1 two-component response regulator VFG0596 Protein 8e-36 41
BBR47_28050 YP_002772286.1 two-component response regulator VFG1702 Protein 1e-34 41