Gene Information

Name : Deide_01470 (Deide_01470)
Accession : YP_002784710.1
Strain : Deinococcus deserti VCD115
Genome accession: NC_012526
Putative virulence/resistance : Virulence
Product : response regulator CheY
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 169222 - 169926 bp
Length : 705 bp
Strand : +
Note : -

DNA sequence :
ATGAGAACGCTTCATACACTAGCGTCCATGGAACGCAAACCGCTCGTCCTCGTTATCGAGGATGAAAAAGACATTGCCCG
CTTTATCGAACTGGAACTTGCCGCTGAAGGCTATGCCACCGAGGTGGCCTTTGATGGTGTCACCGGTCTGTCGAAATTTC
GTGAAGTCAACCCTGATCTGGTGATCCTGGATTTGATGTTGCCGGTGCTTGATGGTCTGGAAGTGGCCCGCCGTATCCGG
AAGACCAGCAACACGCCGATCATCATCCTGACCGCCAAAGACGGTATTCAGGACAAGGTCGAGGGCCTGGACTCCGGGGC
CGACGATTACCTGATCAAGCCGTTTTCTATCGAGGAACTGCTGGCCCGCGTGCGCGCCCACCTGCGCCGTGTGAACCCGG
CCGTGACCGGCGAGGTACGCGTCGCCGACCTGGTCATGAACCTCGATGGCCGTGAGATCTTCCGTGGAGGCCGCCGTGTG
GAGTTGTCGGCCAAGGAATTTGAACTGCTCGAACTGCTGGCCCGCAACCCGGGCAAGGTGTTCTCGCGCTTTGAGATCGA
AGAGAAGGTCTGGCCGGAATACACCGGGGGCAGCAACGTTGTGGACGTGTATATCGGTTACCTGCGCCGCAAGCTTGAAG
AGGGTGGAGAGCGCCGCCTGATTCACACAGTCCGCGGCGTAGGATACGTACTGCGCGAAGAGTAA

Protein sequence :
MRTLHTLASMERKPLVLVIEDEKDIARFIELELAAEGYATEVAFDGVTGLSKFREVNPDLVILDLMLPVLDGLEVARRIR
KTSNTPIIILTAKDGIQDKVEGLDSGADDYLIKPFSIEELLARVRAHLRRVNPAVTGEVRVADLVMNLDGREIFRGGRRV
ELSAKEFELLELLARNPGKVFSRFEIEEKVWPEYTGGSNVVDVYIGYLRRKLEEGGERRLIHTVRGVGYVLREE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 7e-28 43
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 2e-27 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Deide_01470 YP_002784710.1 response regulator CheY HE999704.1.gene1528. Protein 7e-33 48
Deide_01470 YP_002784710.1 response regulator CheY BAC0125 Protein 9e-35 46
Deide_01470 YP_002784710.1 response regulator CheY NC_003923.1003417.p0 Protein 3e-33 45
Deide_01470 YP_002784710.1 response regulator CheY AE015929.1.gene1106. Protein 2e-28 45
Deide_01470 YP_002784710.1 response regulator CheY NC_013450.8614146.p0 Protein 3e-33 45
Deide_01470 YP_002784710.1 response regulator CheY NC_002951.3238224.p0 Protein 3e-33 45
Deide_01470 YP_002784710.1 response regulator CheY NC_007793.3914065.p0 Protein 3e-33 45
Deide_01470 YP_002784710.1 response regulator CheY NC_002758.1121390.p0 Protein 3e-33 45
Deide_01470 YP_002784710.1 response regulator CheY NC_010079.5776364.p0 Protein 3e-33 45
Deide_01470 YP_002784710.1 response regulator CheY NC_002952.2859858.p0 Protein 3e-33 45
Deide_01470 YP_002784710.1 response regulator CheY NC_007622.3794948.p0 Protein 3e-33 45
Deide_01470 YP_002784710.1 response regulator CheY NC_012469.1.7685629. Protein 1e-27 45
Deide_01470 YP_002784710.1 response regulator CheY BAC0197 Protein 8e-30 45
Deide_01470 YP_002784710.1 response regulator CheY BAC0083 Protein 6e-31 43
Deide_01470 YP_002784710.1 response regulator CheY BAC0308 Protein 3e-32 43
Deide_01470 YP_002784710.1 response regulator CheY BAC0638 Protein 2e-22 43
Deide_01470 YP_002784710.1 response regulator CheY BAC0347 Protein 4e-26 41
Deide_01470 YP_002784710.1 response regulator CheY BAC0111 Protein 4e-29 41
Deide_01470 YP_002784710.1 response regulator CheY NC_003923.1003749.p0 Protein 1e-25 41
Deide_01470 YP_002784710.1 response regulator CheY HE999704.1.gene2815. Protein 1e-24 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Deide_01470 YP_002784710.1 response regulator CheY VFG1390 Protein 6e-37 50
Deide_01470 YP_002784710.1 response regulator CheY VFG1389 Protein 4e-26 45
Deide_01470 YP_002784710.1 response regulator CheY VFG0596 Protein 3e-28 43
Deide_01470 YP_002784710.1 response regulator CheY VFG1386 Protein 1e-28 42