Gene Information

Name : mtrA (cauri_0674)
Accession : YP_002834209.1
Strain : Corynebacterium aurimucosum ATCC 700975
Genome accession: NC_012590
Putative virulence/resistance : Virulence
Product : two-component system response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 736289 - 736975 bp
Length : 687 bp
Strand : +
Note : Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain

DNA sequence :
GTGGCACCGAAAATCTTGGTCGTGGATGATGACCCGGCAATTGCCGAAATGCTTACCATCGTGCTCGAGGCAGAAGGGCT
GGAGCCTATTGCCGTCAACGATGGTAATGAGGCCATCCCGGCCTTCCGCGAGCACGACCCGGATCTGATCCTGTTGGATC
TCATGCTTCCGGGCATGAACGGCGTTGATATCTGCCGTGCCATCCGTACCGAGTCCTCGGTGCCTATCGTGATGCTGACC
GCAAAGACCGATACCGTCGATGTGGTCCTTGGCCTCGAATCAGGGGCGGATGACTACATCACCAAGCCCTTCAAGCCGAA
AGAGCTCATCGCCCGCATCCGTGCGCGCCTGCGCCGGATTGACGGAGGTACAGGCGAAATTATCGAGGTAGGGGACCTGC
TTATCGACGTCCCCGAGCACACCGTCACCCGCAAGGGCGGCGAGGAGATCTCGCTGACCCCGCTGGAGTTCGACCTCCTG
CTGGAAATGGCTCGAAAGCCCGGACAGGTGCACACCCGCGAGGCGTTGCTCGAATCCGTCTGGGGCTACCGCCACGCTTC
CGATACTCGCCTGGTCAACGTGCATGTTCAGCGCCTGCGCGCAAAGATCGAGCATGATCCAGAGGATCCGCACATCGTGC
TCACGGTACGCGGTGTGGGATACAAGACTGGAAAAGTCGCCGAGTAA

Protein sequence :
MAPKILVVDDDPAIAEMLTIVLEAEGLEPIAVNDGNEAIPAFREHDPDLILLDLMLPGMNGVDICRAIRTESSVPIVMLT
AKTDTVDVVLGLESGADDYITKPFKPKELIARIRARLRRIDGGTGEIIEVGDLLIDVPEHTVTRKGGEEISLTPLEFDLL
LEMARKPGQVHTREALLESVWGYRHASDTRLVNVHVQRLRAKIEHDPEDPHIVLTVRGVGYKTGKVAE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 5e-31 44
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 1e-30 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
mtrA YP_002834209.1 two-component system response regulator AE000516.2.gene3505. Protein 7e-65 71
mtrA YP_002834209.1 two-component system response regulator NC_012469.1.7685629. Protein 2e-37 49
mtrA YP_002834209.1 two-component system response regulator NC_013450.8614421.p0 Protein 3e-37 46
mtrA YP_002834209.1 two-component system response regulator NC_007793.3914279.p0 Protein 3e-37 46
mtrA YP_002834209.1 two-component system response regulator NC_002745.1124361.p0 Protein 3e-37 46
mtrA YP_002834209.1 two-component system response regulator NC_009782.5559369.p0 Protein 3e-37 46
mtrA YP_002834209.1 two-component system response regulator NC_002951.3237708.p0 Protein 3e-37 46
mtrA YP_002834209.1 two-component system response regulator NC_003923.1003749.p0 Protein 3e-37 46
mtrA YP_002834209.1 two-component system response regulator NC_002758.1121668.p0 Protein 3e-37 46
mtrA YP_002834209.1 two-component system response regulator NC_009641.5332272.p0 Protein 3e-37 46
mtrA YP_002834209.1 two-component system response regulator NC_002952.2859905.p0 Protein 2e-37 46
mtrA YP_002834209.1 two-component system response regulator NC_007622.3794472.p0 Protein 2e-37 46
mtrA YP_002834209.1 two-component system response regulator NC_002952.2859858.p0 Protein 9e-26 45
mtrA YP_002834209.1 two-component system response regulator NC_007622.3794948.p0 Protein 9e-26 45
mtrA YP_002834209.1 two-component system response regulator NC_003923.1003417.p0 Protein 9e-26 45
mtrA YP_002834209.1 two-component system response regulator NC_013450.8614146.p0 Protein 9e-26 45
mtrA YP_002834209.1 two-component system response regulator NC_002951.3238224.p0 Protein 9e-26 45
mtrA YP_002834209.1 two-component system response regulator NC_007793.3914065.p0 Protein 9e-26 45
mtrA YP_002834209.1 two-component system response regulator NC_002758.1121390.p0 Protein 9e-26 45
mtrA YP_002834209.1 two-component system response regulator NC_010079.5776364.p0 Protein 9e-26 45
mtrA YP_002834209.1 two-component system response regulator HE999704.1.gene2815. Protein 2e-33 45
mtrA YP_002834209.1 two-component system response regulator AE016830.1.gene1681. Protein 2e-33 43
mtrA YP_002834209.1 two-component system response regulator BAC0125 Protein 4e-23 43
mtrA YP_002834209.1 two-component system response regulator AF155139.2.orf0.gene Protein 8e-27 42
mtrA YP_002834209.1 two-component system response regulator AE015929.1.gene1106. Protein 4e-20 41
mtrA YP_002834209.1 two-component system response regulator BAC0111 Protein 2e-18 41
mtrA YP_002834209.1 two-component system response regulator NC_012469.1.7686381. Protein 3e-33 41
mtrA YP_002834209.1 two-component system response regulator CP001138.1.gene2239. Protein 1e-26 41
mtrA YP_002834209.1 two-component system response regulator BAC0039 Protein 4e-27 41
mtrA YP_002834209.1 two-component system response regulator BAC0596 Protein 1e-26 41
mtrA YP_002834209.1 two-component system response regulator CP000034.1.gene2186. Protein 4e-27 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
mtrA YP_002834209.1 two-component system response regulator VFG1702 Protein 2e-31 44
mtrA YP_002834209.1 two-component system response regulator VFG1563 Protein 6e-31 43
mtrA YP_002834209.1 two-component system response regulator VFG1390 Protein 3e-22 41
mtrA YP_002834209.1 two-component system response regulator VFG1389 Protein 7e-21 41