Gene Information

Name : cusR (PFLU0959)
Accession : YP_002870621.1
Strain : Pseudomonas fluorescens SBW25
Genome accession: NC_012660
Putative virulence/resistance : Virulence
Product : tw-component system, response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1065936 - 1066628 bp
Length : 693 bp
Strand : -
Note : -

DNA sequence :
ATGCGCGTCCTGATTATTGAAGATGAAGAAAAAACCGCAGACTACCTGCACCGCGGCCTGACGGAGCAAGGCTATACCGT
CGACGTGGCCCGCGAAGGCGTCGAAGGCCTGCACCTGGCCCTGGAGAACGATTATGCGGTGATCGTGCTCGACGTGATGC
TGCCAGGCCTCGATGGCTTTGGCGTACTGCGCGCCTTGCGTGCGCGCAAGCAGACGCCGGTGATCATGCTCACCGCCCGC
GAGCGCGTGGAAGACCGCATCCGTGGTTTGCGCGAAGGCGCCGACGATTACCTGGGCAAGCCGTTTTCCTTCCTGGAACT
GGTGGCACGCCTGCAGGCCCTGACCCGCCGCAGCGGCGGTCATGAGCCGGTGCAGGTGACGGTCGCCGATTTGTGGATCG
ACCTGATCAGCCGCAAGGCCAGCCGTAACGGCGTGCGCCTGGACCTCACCGCCAAGGAGTTCTCGCTGCTCAGCGTGTTG
GCGCGGCGCCAGGGCGAGATCCTGTCCAAGACCGCGATTGCGGAAATGGTCTGGGACATCAATTTCGACAGCGACGCCAA
CGTGGTGGAAGTCGCGATCAAGCGCCTGCGCGCCAAGCTCGACGGGCCATTCGAACAGAAACTGCTGCACACCATCCGTG
GCATGGGGTATGTGCTGGAGAGTCGCCTGGTGGAGACCCCAAGTGGTGGCTAA

Protein sequence :
MRVLIIEDEEKTADYLHRGLTEQGYTVDVAREGVEGLHLALENDYAVIVLDVMLPGLDGFGVLRALRARKQTPVIMLTAR
ERVEDRIRGLREGADDYLGKPFSFLELVARLQALTRRSGGHEPVQVTVADLWIDLISRKASRNGVRLDLTAKEFSLLSVL
ARRQGEILSKTAIAEMVWDINFDSDANVVEVAIKRLRAKLDGPFEQKLLHTIRGMGYVLESRLVETPSGG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 3e-56 57
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 7e-56 57

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
cusR YP_002870621.1 tw-component system, response regulator BAC0197 Protein 3e-59 56
cusR YP_002870621.1 tw-component system, response regulator BAC0125 Protein 4e-63 56
cusR YP_002870621.1 tw-component system, response regulator BAC0083 Protein 4e-57 55
cusR YP_002870621.1 tw-component system, response regulator BAC0638 Protein 2e-50 55
cusR YP_002870621.1 tw-component system, response regulator BAC0111 Protein 2e-57 53
cusR YP_002870621.1 tw-component system, response regulator BAC0347 Protein 9e-52 50
cusR YP_002870621.1 tw-component system, response regulator BAC0308 Protein 2e-54 50
cusR YP_002870621.1 tw-component system, response regulator HE999704.1.gene1528. Protein 7e-32 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
cusR YP_002870621.1 tw-component system, response regulator VFG0596 Protein 1e-56 57
cusR YP_002870621.1 tw-component system, response regulator VFG1389 Protein 2e-39 48
cusR YP_002870621.1 tw-component system, response regulator VFG1386 Protein 2e-35 44
cusR YP_002870621.1 tw-component system, response regulator VFG1390 Protein 3e-39 41