Gene Information

Name : mtrA (ckrop_1505)
Accession : YP_002906777.1
Strain : Corynebacterium kroppenstedtii DSM 44385
Genome accession: NC_012704
Putative virulence/resistance : Virulence
Product : two-component system response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1785727 - 1786473 bp
Length : 747 bp
Strand : -
Note : -

DNA sequence :
ATGAAGGGTAATACCCGGAGCTATCGTAAGTTGCTGCGACTGTGTCTCAGCCATATGCCAGAATATACAAATATGAAGAC
AAAAATCCTCGTTGTCGACGATGACCCGGCCATTGCGGAAATGCTCATGATCGTCCTTCAAGGTGAAGGGTTCGATACGG
TCGTGGTGGGTGATGGTGCAGAGGCCGTGACCGCCGCATCCAACGAGGATCCTGATCTCATTTTGCTCGACGTCATGCTG
CCGAGCATGAACGGGGTCGACGTGTGCCGGGCTATTCGGAAGACGTCAGGGGTGCCCATCGTGATGTTGAGTGCTCGCAC
CGACACTGTCGACGTTGTCTTGGGCTTGGAGTCCGGCGCGGATGATTACATCAATAAGCCGTTTAAGCCGAAAGAACTGG
TGGCGCGCGTTCGTGCGCAGTTGCGGCGTCGTGAGCAGGCCACGGGGGACACCATCCACGTCGGCGATTTGGTTATCGAC
GTTCCGGGGCACATCGTGAAGCGCGATGGGAAGGAAATTCCGCTTACCCCTATCGAGTTCGATCTGCTTACCCAGTTGGC
TAGCCGGCCGAAGCAAGTGCTCACGCGTGAGGAACTGCTGCGGGAAGTGTGGGGATACAAGCAGCCCACGGACACCCGTG
TGTTGAATGTTCATATCAACCGCTTGCGGATCAAGGTCGAGAAGGATCACAAGAATCCGAAGCTGATCCAGGCCGTCCGA
GGAGTGGGTTACAAGATCGGTGAGTAG

Protein sequence :
MKGNTRSYRKLLRLCLSHMPEYTNMKTKILVVDDDPAIAEMLMIVLQGEGFDTVVVGDGAEAVTAASNEDPDLILLDVML
PSMNGVDVCRAIRKTSGVPIVMLSARTDTVDVVLGLESGADDYINKPFKPKELVARVRAQLRRREQATGDTIHVGDLVID
VPGHIVKRDGKEIPLTPIEFDLLTQLASRPKQVLTREELLREVWGYKQPTDTRVLNVHINRLRIKVEKDHKNPKLIQAVR
GVGYKIGE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 2e-35 42
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 3e-35 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
mtrA YP_002906777.1 two-component system response regulator AE000516.2.gene3505. Protein 6e-67 65
mtrA YP_002906777.1 two-component system response regulator NC_002952.2859905.p0 Protein 9e-43 46
mtrA YP_002906777.1 two-component system response regulator NC_007622.3794472.p0 Protein 8e-43 46
mtrA YP_002906777.1 two-component system response regulator NC_013450.8614421.p0 Protein 1e-42 45
mtrA YP_002906777.1 two-component system response regulator NC_007793.3914279.p0 Protein 1e-42 45
mtrA YP_002906777.1 two-component system response regulator NC_002745.1124361.p0 Protein 1e-42 45
mtrA YP_002906777.1 two-component system response regulator NC_009782.5559369.p0 Protein 1e-42 45
mtrA YP_002906777.1 two-component system response regulator NC_002951.3237708.p0 Protein 1e-42 45
mtrA YP_002906777.1 two-component system response regulator NC_003923.1003749.p0 Protein 1e-42 45
mtrA YP_002906777.1 two-component system response regulator NC_002758.1121668.p0 Protein 1e-42 45
mtrA YP_002906777.1 two-component system response regulator NC_009641.5332272.p0 Protein 1e-42 45
mtrA YP_002906777.1 two-component system response regulator AF155139.2.orf0.gene Protein 4e-34 44
mtrA YP_002906777.1 two-component system response regulator NC_012469.1.7685629. Protein 7e-40 44
mtrA YP_002906777.1 two-component system response regulator BAC0125 Protein 5e-31 44
mtrA YP_002906777.1 two-component system response regulator HE999704.1.gene2815. Protein 2e-37 42
mtrA YP_002906777.1 two-component system response regulator NC_007622.3794948.p0 Protein 2e-34 41
mtrA YP_002906777.1 two-component system response regulator NC_003923.1003417.p0 Protein 2e-34 41
mtrA YP_002906777.1 two-component system response regulator NC_013450.8614146.p0 Protein 2e-34 41
mtrA YP_002906777.1 two-component system response regulator NC_002951.3238224.p0 Protein 2e-34 41
mtrA YP_002906777.1 two-component system response regulator NC_007793.3914065.p0 Protein 2e-34 41
mtrA YP_002906777.1 two-component system response regulator NC_002758.1121390.p0 Protein 2e-34 41
mtrA YP_002906777.1 two-component system response regulator NC_010079.5776364.p0 Protein 2e-34 41
mtrA YP_002906777.1 two-component system response regulator NC_002952.2859858.p0 Protein 2e-34 41
mtrA YP_002906777.1 two-component system response regulator HE999704.1.gene1528. Protein 1e-35 41
mtrA YP_002906777.1 two-component system response regulator BAC0197 Protein 1e-28 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
mtrA YP_002906777.1 two-component system response regulator VFG1389 Protein 5e-30 44
mtrA YP_002906777.1 two-component system response regulator VFG1390 Protein 5e-35 43
mtrA YP_002906777.1 two-component system response regulator VFG1563 Protein 1e-35 42
mtrA YP_002906777.1 two-component system response regulator VFG1702 Protein 1e-35 41