Gene Information

Name : KP1_1855 (KP1_1855)
Accession : YP_002918653.1
Strain : Klebsiella pneumoniae NTUH-K2044
Genome accession: NC_012731
Putative virulence/resistance : Virulence
Product : putative positive response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1795625 - 1796341 bp
Length : 717 bp
Strand : +
Note : internal ID: KP1855

DNA sequence :
ATGGCCAAAACCATTCTGCTGGTGGAAGATGACGAGGATATAGCCACGCTGCTGCGGCTCAATCTTCAGGATGAGGGCTA
TCAGATCGTCCATGAAGCCGACGGCGGCCAGGCCCTCGCCCGGCTGGAGACGCAGGTCTGGGATGCGGTGATCCTCGATT
TGATGCTGCCCGGCGTCGATGGTCTGGAGATCTGCCGGCGTATCCGCCAGATGACCCGCTACCTGCCGGTGATTATCATC
AGCGCTCGCACCAGCGAAATGCACCGCGTGCTGGGCCTGGAGATGGGCGCCGACGACTATCTGGCGAAGCCCTTTTCATT
GCTGGAGCTTATCGCCCGCGTCAAAGCGCTGTTTCGTCGCCAGGAGGCGATGGGGCAGAATCTGCTGATGGACGCCGGGC
GCCTGTCCTGCCATGGCCTGAGCATCGACCCGCTGTCGCGCGAAGTGAAGCTGCGCGGCGAGACGGTGGACCTCACGCCG
CGTGAATTCGACCTGCTGTATTACTTCGCCCGCCACCCCGGGGAAGTGTTTTCCCGGCTGGCGCTGCTGGAGCAGGTCTG
GGGATATCAGCACGAGGGCTATGAGCATACCGTCAATACCCATATCAACCGCCTGCGCAGTAAAATCGAACGTGACCCGG
CCGAGCCGGACATCATTCTTACCGTCTGGGGAAAAGGCTATAAGTTCGCCCCGGTGACGCAAGAGGCCGCCCCGTGA

Protein sequence :
MAKTILLVEDDEDIATLLRLNLQDEGYQIVHEADGGQALARLETQVWDAVILDLMLPGVDGLEICRRIRQMTRYLPVIII
SARTSEMHRVLGLEMGADDYLAKPFSLLELIARVKALFRRQEAMGQNLLMDAGRLSCHGLSIDPLSREVKLRGETVDLTP
REFDLLYYFARHPGEVFSRLALLEQVWGYQHEGYEHTVNTHINRLRSKIERDPAEPDIILTVWGKGYKFAPVTQEAAP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 2e-85 79
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 3e-85 79

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
KP1_1855 YP_002918653.1 putative positive response regulator NC_012469.1.7685629. Protein 7e-44 46
KP1_1855 YP_002918653.1 putative positive response regulator AE000516.2.gene3505. Protein 1e-39 45
KP1_1855 YP_002918653.1 putative positive response regulator NC_012469.1.7686381. Protein 2e-41 43
KP1_1855 YP_002918653.1 putative positive response regulator FJ349556.1.orf0.gene Protein 5e-39 42
KP1_1855 YP_002918653.1 putative positive response regulator HE999704.1.gene1528. Protein 1e-33 42
KP1_1855 YP_002918653.1 putative positive response regulator BAC0533 Protein 1e-29 42
KP1_1855 YP_002918653.1 putative positive response regulator CP000647.1.gene4257. Protein 1e-29 42
KP1_1855 YP_002918653.1 putative positive response regulator NC_002951.3238224.p0 Protein 6e-36 41
KP1_1855 YP_002918653.1 putative positive response regulator AE015929.1.gene1106. Protein 9e-31 41
KP1_1855 YP_002918653.1 putative positive response regulator NC_007793.3914065.p0 Protein 6e-36 41
KP1_1855 YP_002918653.1 putative positive response regulator NC_002758.1121390.p0 Protein 6e-36 41
KP1_1855 YP_002918653.1 putative positive response regulator NC_010079.5776364.p0 Protein 6e-36 41
KP1_1855 YP_002918653.1 putative positive response regulator NC_002952.2859858.p0 Protein 6e-36 41
KP1_1855 YP_002918653.1 putative positive response regulator NC_007622.3794948.p0 Protein 6e-36 41
KP1_1855 YP_002918653.1 putative positive response regulator NC_003923.1003417.p0 Protein 6e-36 41
KP1_1855 YP_002918653.1 putative positive response regulator NC_013450.8614146.p0 Protein 6e-36 41
KP1_1855 YP_002918653.1 putative positive response regulator AF155139.2.orf0.gene Protein 1e-42 41
KP1_1855 YP_002918653.1 putative positive response regulator CP001138.1.gene4273. Protein 3e-29 41
KP1_1855 YP_002918653.1 putative positive response regulator AE016830.1.gene1681. Protein 3e-43 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
KP1_1855 YP_002918653.1 putative positive response regulator VFG1563 Protein 1e-85 79
KP1_1855 YP_002918653.1 putative positive response regulator VFG1702 Protein 1e-85 79
KP1_1855 YP_002918653.1 putative positive response regulator VFG1389 Protein 5e-31 41