Gene Information

Name : Kole_0551 (Kole_0551)
Accession : YP_002940275.1
Strain : Kosmotoga olearia TBF 19.5.1
Genome accession: NC_012785
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator, winged helix family
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 602197 - 602898 bp
Length : 702 bp
Strand : -
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receiver; KEGG: gsu:GSU0451 DNA-binding response regulator

DNA sequence :
GTGAGAATTCTTCTTGTGGAAGATGAAGAAGCAATCACAGAATTTGTAAAAAAAGGGTTATCGGAAGAAGGATACATTGT
TGATACTGTTGATAATGGAGAAGATGCATTGAATAAGATATTTGATGTGGACTATGATCTAATTATATTAGATATTATGC
TGCCTGTGAAAGACGGTTTAAAAGTATGCCGTGAAGTTCGAGAAAATGGTATTTCAACACCCATACTTATGCTTACAGCC
CTTGATAGCACTGAAGATAAAGTTACCGGATTGAATGCAGGAGCAGATGATTATCTTGTAAAACCATTCTCTTTCAGCGA
ACTTCTTGCACGTATAAGAGCCATCTTAAGGCGTCCTCCCACAATTTTAAATTTGAAGCTTCAAGTAGGCGATCTTGTCC
TTGATACTGTAACCCATCATGTTGAGCGCTCTGGAAAGAGGATAGACTTAACACCAAGAGAATATGCACTGCTGGAGTTC
TTAATGCGTCATCCAAATCAAGTATTGAGCAGAACACGAATAGTTGAACACGTCTGGAACTTAGATTTTTATACAGAGTC
AAACATTGTAGATGTATACATACGCTATTTGAGAAAGAAAATAGACAATGGGTTTGAGAACAAACTAATACATACAGTAC
ATGGTGTGGGGTATATGATAGGAGAAATACAGCCAAATAAAAGTAAGGGAGGCGAATCTTGA

Protein sequence :
MRILLVEDEEAITEFVKKGLSEEGYIVDTVDNGEDALNKIFDVDYDLIILDIMLPVKDGLKVCREVRENGISTPILMLTA
LDSTEDKVTGLNAGADDYLVKPFSFSELLARIRAILRRPPTILNLKLQVGDLVLDTVTHHVERSGKRIDLTPREYALLEF
LMRHPNQVLSRTRIVEHVWNLDFYTESNIVDVYIRYLRKKIDNGFENKLIHTVHGVGYMIGEIQPNKSKGGES

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-41 48
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 6e-41 47

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Kole_0551 YP_002940275.1 two component transcriptional regulator, winged helix family BAC0125 Protein 8e-50 49
Kole_0551 YP_002940275.1 two component transcriptional regulator, winged helix family NC_003923.1003417.p0 Protein 3e-36 49
Kole_0551 YP_002940275.1 two component transcriptional regulator, winged helix family NC_013450.8614146.p0 Protein 3e-36 49
Kole_0551 YP_002940275.1 two component transcriptional regulator, winged helix family NC_002951.3238224.p0 Protein 3e-36 49
Kole_0551 YP_002940275.1 two component transcriptional regulator, winged helix family NC_007793.3914065.p0 Protein 3e-36 49
Kole_0551 YP_002940275.1 two component transcriptional regulator, winged helix family NC_002758.1121390.p0 Protein 3e-36 49
Kole_0551 YP_002940275.1 two component transcriptional regulator, winged helix family NC_010079.5776364.p0 Protein 3e-36 49
Kole_0551 YP_002940275.1 two component transcriptional regulator, winged helix family NC_002952.2859858.p0 Protein 3e-36 49
Kole_0551 YP_002940275.1 two component transcriptional regulator, winged helix family NC_007622.3794948.p0 Protein 3e-36 49
Kole_0551 YP_002940275.1 two component transcriptional regulator, winged helix family BAC0111 Protein 1e-48 49
Kole_0551 YP_002940275.1 two component transcriptional regulator, winged helix family BAC0308 Protein 7e-44 49
Kole_0551 YP_002940275.1 two component transcriptional regulator, winged helix family BAC0083 Protein 3e-46 48
Kole_0551 YP_002940275.1 two component transcriptional regulator, winged helix family BAC0197 Protein 3e-43 47
Kole_0551 YP_002940275.1 two component transcriptional regulator, winged helix family BAC0347 Protein 7e-43 46
Kole_0551 YP_002940275.1 two component transcriptional regulator, winged helix family BAC0638 Protein 1e-39 45
Kole_0551 YP_002940275.1 two component transcriptional regulator, winged helix family AE015929.1.gene1106. Protein 6e-33 44
Kole_0551 YP_002940275.1 two component transcriptional regulator, winged helix family HE999704.1.gene1528. Protein 1e-34 43
Kole_0551 YP_002940275.1 two component transcriptional regulator, winged helix family FJ349556.1.orf0.gene Protein 1e-26 43
Kole_0551 YP_002940275.1 two component transcriptional regulator, winged helix family AF155139.2.orf0.gene Protein 3e-27 42
Kole_0551 YP_002940275.1 two component transcriptional regulator, winged helix family NC_002516.2.879194.p Protein 9e-30 41
Kole_0551 YP_002940275.1 two component transcriptional regulator, winged helix family BAC0288 Protein 6e-30 41
Kole_0551 YP_002940275.1 two component transcriptional regulator, winged helix family AE000516.2.gene3505. Protein 1e-33 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Kole_0551 YP_002940275.1 two component transcriptional regulator, winged helix family VFG0596 Protein 6e-42 48
Kole_0551 YP_002940275.1 two component transcriptional regulator, winged helix family VFG1390 Protein 3e-47 47
Kole_0551 YP_002940275.1 two component transcriptional regulator, winged helix family VFG1386 Protein 3e-38 42
Kole_0551 YP_002940275.1 two component transcriptional regulator, winged helix family VFG1389 Protein 5e-32 41