Gene Information

Name : DMR_02640 (DMR_02640)
Accession : YP_002951641.1
Strain : Desulfovibrio magneticus RS-1
Genome accession: NC_012796
Putative virulence/resistance : Virulence
Product : OmpR family two-component response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 286114 - 286797 bp
Length : 684 bp
Strand : -
Note : -

DNA sequence :
ATGTCCAAGGATTCCATCCTGATTGTCGAAGATGACGAAGATATCGTCGAACTGCTCGCCTTCAATCTGCAAAGCGCCGG
CTTCGCCGCCGAGACCGCCCGCGACGGTTACGAGGGCCTGGCCAAGGCCCGGCGCAATCCGCCGGCCGCCGTCATCCTCG
ACCTCATGCTGCCGGGGCTGGACGGCTTCGAGGTCTGCAAGGAACTCAAGCGCGACCCCAAGACCGCCAGCGCCCCCATC
ATCATGCTGACGGCCCGGGGCGAGGAAGTGGACCGCATCGTCGGGCTGGAGCTTGGGGCCGACGACTACGTGGTCAAGCC
CTTTTCCCCGCGCGAACTGGTCCTGCGCCTGCGCTCGGTGCTCAAACGCCACGCCCCGGAGCCGGAAAAACGGCAGGTGC
TGGCCCGCGACGGCCTGTCCGTGGACATGGCCGCCCACCGGGTGAGCCTGGACGGGGCCGAGGTGGCGCTCACCGCCACG
GAATTCAAGCTCTTGGCCGAGCTGTTCCAGAGCGCCGGCCGGGTGCTCACCCGGGACCGGCTGCTCAATTCCGTCTGGGG
CTACGAGTTCGAGGGCTACGCCCGCACCGTGGACACCCACGTGCGCCGCCTGCGCCAGAAGCTTGGGCATTTCGCCGACA
TGATCGAGACCGTCCGGGGCGTGGGCTACCGGTTCAAGGAGTAG

Protein sequence :
MSKDSILIVEDDEDIVELLAFNLQSAGFAAETARDGYEGLAKARRNPPAAVILDLMLPGLDGFEVCKELKRDPKTASAPI
IMLTARGEEVDRIVGLELGADDYVVKPFSPRELVLRLRSVLKRHAPEPEKRQVLARDGLSVDMAAHRVSLDGAEVALTAT
EFKLLAELFQSAGRVLTRDRLLNSVWGYEFEGYARTVDTHVRRLRQKLGHFADMIETVRGVGYRFKE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 6e-32 41
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 6e-38 41
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 5e-31 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
DMR_02640 YP_002951641.1 OmpR family two-component response regulator NC_012469.1.7685629. Protein 9e-40 44
DMR_02640 YP_002951641.1 OmpR family two-component response regulator HE999704.1.gene2815. Protein 2e-41 44
DMR_02640 YP_002951641.1 OmpR family two-component response regulator HE999704.1.gene1528. Protein 2e-32 43
DMR_02640 YP_002951641.1 OmpR family two-component response regulator NC_003923.1003749.p0 Protein 2e-42 43
DMR_02640 YP_002951641.1 OmpR family two-component response regulator BAC0197 Protein 1e-31 43
DMR_02640 YP_002951641.1 OmpR family two-component response regulator AE000516.2.gene3505. Protein 5e-41 43
DMR_02640 YP_002951641.1 OmpR family two-component response regulator NC_008702.1.4607594. Protein 5e-35 43
DMR_02640 YP_002951641.1 OmpR family two-component response regulator NC_002952.2859905.p0 Protein 2e-42 42
DMR_02640 YP_002951641.1 OmpR family two-component response regulator NC_013450.8614421.p0 Protein 2e-42 42
DMR_02640 YP_002951641.1 OmpR family two-component response regulator NC_007793.3914279.p0 Protein 2e-42 42
DMR_02640 YP_002951641.1 OmpR family two-component response regulator NC_002745.1124361.p0 Protein 2e-42 42
DMR_02640 YP_002951641.1 OmpR family two-component response regulator NC_009782.5559369.p0 Protein 2e-42 42
DMR_02640 YP_002951641.1 OmpR family two-component response regulator NC_002951.3237708.p0 Protein 2e-42 42
DMR_02640 YP_002951641.1 OmpR family two-component response regulator NC_007622.3794472.p0 Protein 2e-42 42
DMR_02640 YP_002951641.1 OmpR family two-component response regulator NC_002758.1121668.p0 Protein 2e-42 42
DMR_02640 YP_002951641.1 OmpR family two-component response regulator NC_009641.5332272.p0 Protein 2e-42 42
DMR_02640 YP_002951641.1 OmpR family two-component response regulator CP001918.1.gene5135. Protein 3e-25 42
DMR_02640 YP_002951641.1 OmpR family two-component response regulator NC_012469.1.7686381. Protein 4e-41 41
DMR_02640 YP_002951641.1 OmpR family two-component response regulator NC_002951.3238224.p0 Protein 2e-42 41
DMR_02640 YP_002951641.1 OmpR family two-component response regulator NC_007793.3914065.p0 Protein 2e-42 41
DMR_02640 YP_002951641.1 OmpR family two-component response regulator NC_002758.1121390.p0 Protein 2e-42 41
DMR_02640 YP_002951641.1 OmpR family two-component response regulator NC_010079.5776364.p0 Protein 2e-42 41
DMR_02640 YP_002951641.1 OmpR family two-component response regulator NC_002952.2859858.p0 Protein 2e-42 41
DMR_02640 YP_002951641.1 OmpR family two-component response regulator NC_007622.3794948.p0 Protein 2e-42 41
DMR_02640 YP_002951641.1 OmpR family two-component response regulator NC_003923.1003417.p0 Protein 2e-42 41
DMR_02640 YP_002951641.1 OmpR family two-component response regulator NC_013450.8614146.p0 Protein 2e-42 41
DMR_02640 YP_002951641.1 OmpR family two-component response regulator CP000675.2.gene1535. Protein 1e-41 41
DMR_02640 YP_002951641.1 OmpR family two-component response regulator CP001485.1.gene721.p Protein 5e-32 41
DMR_02640 YP_002951641.1 OmpR family two-component response regulator CP001138.1.gene2239. Protein 3e-37 41
DMR_02640 YP_002951641.1 OmpR family two-component response regulator CP000034.1.gene2186. Protein 7e-38 41
DMR_02640 YP_002951641.1 OmpR family two-component response regulator BAC0039 Protein 7e-38 41
DMR_02640 YP_002951641.1 OmpR family two-component response regulator CP001918.1.gene3444. Protein 4e-37 41
DMR_02640 YP_002951641.1 OmpR family two-component response regulator BAC0596 Protein 3e-37 41
DMR_02640 YP_002951641.1 OmpR family two-component response regulator NC_002695.1.916589.p Protein 7e-38 41
DMR_02640 YP_002951641.1 OmpR family two-component response regulator CP000647.1.gene2531. Protein 3e-38 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
DMR_02640 YP_002951641.1 OmpR family two-component response regulator VFG1386 Protein 4e-37 42
DMR_02640 YP_002951641.1 OmpR family two-component response regulator VFG0596 Protein 2e-32 41
DMR_02640 YP_002951641.1 OmpR family two-component response regulator VFG1563 Protein 3e-38 41