Gene Information

Name : Rpic12D_5099 (Rpic12D_5099)
Accession : YP_002973577.1
Strain :
Genome accession: NC_012849
Putative virulence/resistance : Virulence
Product : two component heavy metal response transcriptional regulator, winged helix family
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1505 - 2191 bp
Length : 687 bp
Strand : -
Note : KEGG: rso:RSp0655 two component response regulator transcription regulator protein; TIGRFAM: heavy metal response regulator; PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receiver

DNA sequence :
ATGAAGCTCCTTGTTGTCGAAGACGAATCCAAGACTGGCGAATATTTGCAGCAGGGGCTGTCGGAAGCCGGCTTTGTTGT
TGACCTCGCCCGTAATGGGATGGACGGCCGTCATCTTGCAATGACGGGCGACTATGACCTCTTGATCCTTGACGTGATGT
TGCCCGATCTCGAGGGGTGGCAGATTCTGCACGCGCTGCGCTCAGCTGAACTGGCCGTACCGGTGCTGTTTCTGACCGCG
CGCGATAGCGTCGCCGATCGGGTCAAGGGCTTGGAACTAGGCGCGGACGATTACTTGGTGAAACCTTTTGCATTCGCGGA
ATTGCTCGCCCGTGTTCGGAGCCTGCTTCGACGAGGCAGTGCGCCATCACTTGCAGAACGCATCCAGGTGGCCGACCTGG
TGCTGGATCTGACTCGCCGCCGTGCTTCCCGCGGCGGGCAGCGAATCGCGTTGACCAGTAAGGAATTCTCGTTGCTCGAA
CTGCTAGCCCGCCGTCATGGGGAGGTGCTGCCCCGATCCCTGATCGCGTCCCAAGTCTGGGACATGAATTTCGACAGCGA
CACCAACGTGATTGACGTCGCCATTCGACGCCTGCGCGCCAAAATTGACGATAACTTCGAACCCAAATTGATCCATACCG
TTCGTGGTATGGGTTATGTCCTCGAAGGCCCGGAGGATGGGGAGTAA

Protein sequence :
MKLLVVEDESKTGEYLQQGLSEAGFVVDLARNGMDGRHLAMTGDYDLLILDVMLPDLEGWQILHALRSAELAVPVLFLTA
RDSVADRVKGLELGADDYLVKPFAFAELLARVRSLLRRGSAPSLAERIQVADLVLDLTRRRASRGGQRIALTSKEFSLLE
LLARRHGEVLPRSLIASQVWDMNFDSDTNVIDVAIRRLRAKIDDNFEPKLIHTVRGMGYVLEGPEDGE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-61 62
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 2e-60 60

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Rpic12D_5099 YP_002973577.1 two component heavy metal response transcriptional regulator, winged helix family BAC0083 Protein 1e-76 71
Rpic12D_5099 YP_002973577.1 two component heavy metal response transcriptional regulator, winged helix family BAC0111 Protein 3e-79 71
Rpic12D_5099 YP_002973577.1 two component heavy metal response transcriptional regulator, winged helix family BAC0638 Protein 7e-69 68
Rpic12D_5099 YP_002973577.1 two component heavy metal response transcriptional regulator, winged helix family BAC0197 Protein 1e-69 68
Rpic12D_5099 YP_002973577.1 two component heavy metal response transcriptional regulator, winged helix family BAC0125 Protein 3e-68 66
Rpic12D_5099 YP_002973577.1 two component heavy metal response transcriptional regulator, winged helix family BAC0308 Protein 2e-68 66
Rpic12D_5099 YP_002973577.1 two component heavy metal response transcriptional regulator, winged helix family BAC0347 Protein 2e-68 65
Rpic12D_5099 YP_002973577.1 two component heavy metal response transcriptional regulator, winged helix family NC_002516.2.879194.p Protein 6e-31 42
Rpic12D_5099 YP_002973577.1 two component heavy metal response transcriptional regulator, winged helix family BAC0487 Protein 3e-32 41
Rpic12D_5099 YP_002973577.1 two component heavy metal response transcriptional regulator, winged helix family NC_002952.2859905.p0 Protein 1e-32 41
Rpic12D_5099 YP_002973577.1 two component heavy metal response transcriptional regulator, winged helix family NC_009641.5332272.p0 Protein 8e-33 41
Rpic12D_5099 YP_002973577.1 two component heavy metal response transcriptional regulator, winged helix family NC_013450.8614421.p0 Protein 8e-33 41
Rpic12D_5099 YP_002973577.1 two component heavy metal response transcriptional regulator, winged helix family NC_007793.3914279.p0 Protein 8e-33 41
Rpic12D_5099 YP_002973577.1 two component heavy metal response transcriptional regulator, winged helix family NC_002745.1124361.p0 Protein 8e-33 41
Rpic12D_5099 YP_002973577.1 two component heavy metal response transcriptional regulator, winged helix family NC_009782.5559369.p0 Protein 8e-33 41
Rpic12D_5099 YP_002973577.1 two component heavy metal response transcriptional regulator, winged helix family NC_002951.3237708.p0 Protein 8e-33 41
Rpic12D_5099 YP_002973577.1 two component heavy metal response transcriptional regulator, winged helix family NC_007622.3794472.p0 Protein 1e-32 41
Rpic12D_5099 YP_002973577.1 two component heavy metal response transcriptional regulator, winged helix family NC_002758.1121668.p0 Protein 8e-33 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Rpic12D_5099 YP_002973577.1 two component heavy metal response transcriptional regulator, winged helix family VFG0596 Protein 6e-62 62
Rpic12D_5099 YP_002973577.1 two component heavy metal response transcriptional regulator, winged helix family VFG1390 Protein 4e-44 47
Rpic12D_5099 YP_002973577.1 two component heavy metal response transcriptional regulator, winged helix family VFG1389 Protein 4e-37 47
Rpic12D_5099 YP_002973577.1 two component heavy metal response transcriptional regulator, winged helix family VFG1386 Protein 8e-36 41