Gene Information

Name : Rpic12D_5335 (Rpic12D_5335)
Accession : YP_002973803.1
Strain :
Genome accession: NC_012849
Putative virulence/resistance : Virulence
Product : two component heavy metal response transcriptional regulator, winged helix family
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 225118 - 225804 bp
Length : 687 bp
Strand : -
Note : KEGG: rso:RSp0655 two component response regulator transcription regulator protein; TIGRFAM: heavy metal response regulator; PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receiver

DNA sequence :
ATGAAACTGTTGGTCGTCGAGGACGAGCCCAAAACCGGAGAGTATCTGCAGCAAGGCCTGACCGAAGCCGGCTTTGTGGT
CGATCTGGCACGCAACGGTACTGACGGCCGCCATCTGGCCATGTCGGGCGACTACGACTTGCTGTTGCTGGACGTGATGC
TGCCTGACGTGGATGGCTGGCAGATCGTCCAATCGTTGCGCGCTGCGGAACAGGCGGTGCCGGTGTTGTTCTTGACCGCC
CGCGACAGCGTGGCCGACCGCGTCAAAGGCCTTGAAATGGGCGCCGACGACTACTTGGTGAAGCCATTCGCGTTTGCTGA
GTTGCTAGCCCGGGTCCGCACGCTGCTGCGCCGGGGAACCGGTGCCGTCTCGTCCGACCGAATCCAAGTGGCCGACCTTG
TGCTGGATTTGGCTCGCCGTCGTGCCTCACGCGGAGGCCAGAAGATCCCGCTGACGAGCAAGGAGTTCTCCCTGCTGGAG
CTGCTGGTCCGCCGCCGTGGCGAGGTCTTGCCTCGCTCCCTGATCGCCTCGCAGGTCTGGGACATGAACTTCGACAGTGA
TACCAATGTGATCGACGTCGCCATTCGCCGGTTGCGCGCCAAGATCGACGACCACTTCGAGCCGAAGCTGATCCAAACGG
TACGCGGCATGGGTTATGTACTGGAAGCGCCCGAGGACGCGGCCTGA

Protein sequence :
MKLLVVEDEPKTGEYLQQGLTEAGFVVDLARNGTDGRHLAMSGDYDLLLLDVMLPDVDGWQIVQSLRAAEQAVPVLFLTA
RDSVADRVKGLEMGADDYLVKPFAFAELLARVRTLLRRGTGAVSSDRIQVADLVLDLARRRASRGGQKIPLTSKEFSLLE
LLVRRRGEVLPRSLIASQVWDMNFDSDTNVIDVAIRRLRAKIDDHFEPKLIQTVRGMGYVLEAPEDAA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 8e-47 61
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 8e-46 59

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Rpic12D_5335 YP_002973803.1 two component heavy metal response transcriptional regulator, winged helix family BAC0111 Protein 2e-63 71
Rpic12D_5335 YP_002973803.1 two component heavy metal response transcriptional regulator, winged helix family BAC0083 Protein 7e-61 70
Rpic12D_5335 YP_002973803.1 two component heavy metal response transcriptional regulator, winged helix family BAC0638 Protein 1e-58 70
Rpic12D_5335 YP_002973803.1 two component heavy metal response transcriptional regulator, winged helix family BAC0197 Protein 2e-53 65
Rpic12D_5335 YP_002973803.1 two component heavy metal response transcriptional regulator, winged helix family BAC0125 Protein 1e-52 65
Rpic12D_5335 YP_002973803.1 two component heavy metal response transcriptional regulator, winged helix family BAC0347 Protein 4e-53 64
Rpic12D_5335 YP_002973803.1 two component heavy metal response transcriptional regulator, winged helix family BAC0308 Protein 2e-53 64
Rpic12D_5335 YP_002973803.1 two component heavy metal response transcriptional regulator, winged helix family BAC0487 Protein 1e-22 42
Rpic12D_5335 YP_002973803.1 two component heavy metal response transcriptional regulator, winged helix family HE999704.1.gene1528. Protein 1e-20 42
Rpic12D_5335 YP_002973803.1 two component heavy metal response transcriptional regulator, winged helix family NC_010079.5776364.p0 Protein 5e-25 41
Rpic12D_5335 YP_002973803.1 two component heavy metal response transcriptional regulator, winged helix family NC_002952.2859858.p0 Protein 5e-25 41
Rpic12D_5335 YP_002973803.1 two component heavy metal response transcriptional regulator, winged helix family NC_007622.3794948.p0 Protein 5e-25 41
Rpic12D_5335 YP_002973803.1 two component heavy metal response transcriptional regulator, winged helix family NC_003923.1003417.p0 Protein 5e-25 41
Rpic12D_5335 YP_002973803.1 two component heavy metal response transcriptional regulator, winged helix family NC_013450.8614146.p0 Protein 5e-25 41
Rpic12D_5335 YP_002973803.1 two component heavy metal response transcriptional regulator, winged helix family NC_002951.3238224.p0 Protein 5e-25 41
Rpic12D_5335 YP_002973803.1 two component heavy metal response transcriptional regulator, winged helix family NC_007793.3914065.p0 Protein 5e-25 41
Rpic12D_5335 YP_002973803.1 two component heavy metal response transcriptional regulator, winged helix family NC_002758.1121390.p0 Protein 5e-25 41
Rpic12D_5335 YP_002973803.1 two component heavy metal response transcriptional regulator, winged helix family NC_002516.2.879194.p Protein 2e-22 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Rpic12D_5335 YP_002973803.1 two component heavy metal response transcriptional regulator, winged helix family VFG0596 Protein 3e-47 61
Rpic12D_5335 YP_002973803.1 two component heavy metal response transcriptional regulator, winged helix family VFG1389 Protein 6e-29 47
Rpic12D_5335 YP_002973803.1 two component heavy metal response transcriptional regulator, winged helix family VFG1390 Protein 2e-34 45
Rpic12D_5335 YP_002973803.1 two component heavy metal response transcriptional regulator, winged helix family VFG1386 Protein 1e-25 41