Gene Information

Name : fliQ (Rleg_0376)
Accession : YP_002974226.1
Strain : Rhizobium leguminosarum WSM1325
Genome accession: NC_012850
Putative virulence/resistance : Virulence
Product : flagellar biosynthesis protein FliQ
Function : -
COG functional category : N : Cell motility
COG ID : COG1987
EC number : -
Position : 384126 - 384392 bp
Length : 267 bp
Strand : +
Note : FliQ, with proteins FliP and FliR, forms the core of the central channel in the flagella export apparatus; Bradyrhizobium have one thick flagellum and several thin flagella; the protein in this cluster is associated with the thick flagellum

DNA sequence :
ATGAATGAAGCTGATGCATTGGATCTGTTCCAGGCGGCGATCTGGACCGTGTTGATTGCTGCCGGTCCCGCCGTCATCGC
CGCGATGGTGGTAGGTCTCGTCATTGCCTTGATCCAGGCGCTGACCCAGGTGCAGGAAGCGACACTGACTTTCGTGCCGA
AGATCGTCGCGGTGCTGATCACGGTCGGTGTCACCGCGCCGTTCGTCGGTTCGCAGATCTCGATTTTCACCAATCTGGTC
TTCTCGCGCATCCAGTCCGGCTTCTAG

Protein sequence :
MNEADALDLFQAAIWTVLIAAGPAVIAAMVVGLVIALIQALTQVQEATLTFVPKIVAVLITVGVTAPFVGSQISIFTNLV
FSRIQSGF

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
lscS AAO18039.1 LscS Virulence TTSS locus Protein 4e-11 44
escS AAK26701.1 EscS Virulence LEE Protein 1e-09 42
escS AAL57528.1 EscS Virulence LEE Protein 1e-09 42
escS CAC81848.1 EscS protein Virulence LEE II Protein 1e-09 42
unnamed AAL06355.1 EscS Virulence LEE Protein 1e-09 42
escS YP_003223489.1 T3SS structure protein EscS Virulence LEE Protein 2e-09 42
escS YP_003232139.1 T3SS structure protein EscS Virulence LEE Protein 2e-09 42
escS CAI43888.1 EscS protein Virulence LEE Protein 2e-09 41
escS AFO66401.1 putative LEE-encoded type III secretion system factor Virulence SESS LEE Protein 3e-08 41
escS AFO66341.1 putative LEE-encoded type III secretion system factor Virulence SESS LEE Protein 3e-08 41