Gene Information

Name : Desal_3695 (Desal_3695)
Accession : YP_002993280.1
Strain : Desulfovibrio salexigens DSM 2638
Genome accession: NC_012881
Putative virulence/resistance : Virulence
Product : transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 4140204 - 4140896 bp
Length : 693 bp
Strand : -
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receiver; KEGG: dde:Dde_2387 two component transcriptional regulator

DNA sequence :
GTGTCAGTTGAGAAAATACTGGTTGTTGAAGACCATAACGATACTATTGAGTTGTTGAAGTACAACCTTACCTCTTCCGG
TTACGAGGTTGTAACCGCCATGGACGGGCATAAAGCGCTTGATCAGGCTAGAAAAGAAAACCCGGACCTGATCCTTCTGG
ACTTGATGCTGCCCGGTATAGACGGGCTTGAAGTGTGCCGCAGGCTGAAACAGGAAGTCGCCACTCAGCACATCCCGGTG
ATCATGCTCACCGCCAAGGGAGAGGAAGTGGACCGTGTCGTAGGTCTTGAGCTCGGCGTGGACGATTATATAGTCAAACC
GTTCAGTCCCCGTGAGCTTGTCCTCAGAGTCAAGGCCGTTCTGCGCCGCAGCACAGAACAGCCTGAGCCGCGCCGTCCCG
GAAAATGGAGCCGTGAGGGTCTTTCAGTGGACTTCGAAGCACACACCGTGGAGTGCGATGGTGATCTTGTGGCTCTGACC
GCTACCGAGTTCAAGCTGTTTTCTGAACTCCTGCAACACGAAGGCAAGGTGCGCACCCGTGACCACCTGCTGGATACTGT
CTGGGATACTCATTTTGAAGGCTATTCCAGAACAGTGGATACCCATATCCGCAGGTTGCGTCAGAAGCTGGGACCATACG
CAGACTACATCGAGACTGTTCGTGGCGTAGGCTACCGTTTCAAGCATTCTTAA

Protein sequence :
MSVEKILVVEDHNDTIELLKYNLTSSGYEVVTAMDGHKALDQARKENPDLILLDLMLPGIDGLEVCRRLKQEVATQHIPV
IMLTAKGEEVDRVVGLELGVDDYIVKPFSPRELVLRVKAVLRRSTEQPEPRRPGKWSREGLSVDFEAHTVECDGDLVALT
ATEFKLFSELLQHEGKVRTRDHLLDTVWDTHFEGYSRTVDTHIRRLRQKLGPYADYIETVRGVGYRFKHS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 4e-30 43
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 9e-35 42
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 5e-29 42
mprA YP_005684640.1 response regulator mprA Not tested PiCp 3 Protein 1e-31 41
mprA YP_005680459.1 response regulator mprA Not tested PiCp 3 Protein 1e-31 41
mprA YP_005682550.1 response regulator mprA Not tested PiCp 3 Protein 1e-31 41
tcsR1 YP_003782583.1 two-component system transcriptional regulatory protein Not tested PiCp 3 Protein 1e-31 41
CDB402_0209 YP_005126722.1 two-component system response regulator Not tested Not named Protein 1e-30 41
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 5e-34 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Desal_3695 YP_002993280.1 transcriptional regulator NC_012469.1.7685629. Protein 2e-43 47
Desal_3695 YP_002993280.1 transcriptional regulator NC_002952.2859905.p0 Protein 6e-46 46
Desal_3695 YP_002993280.1 transcriptional regulator NC_009782.5559369.p0 Protein 8e-46 46
Desal_3695 YP_002993280.1 transcriptional regulator NC_002951.3237708.p0 Protein 8e-46 46
Desal_3695 YP_002993280.1 transcriptional regulator NC_003923.1003749.p0 Protein 7e-46 46
Desal_3695 YP_002993280.1 transcriptional regulator NC_002758.1121668.p0 Protein 8e-46 46
Desal_3695 YP_002993280.1 transcriptional regulator NC_007622.3794472.p0 Protein 6e-46 46
Desal_3695 YP_002993280.1 transcriptional regulator NC_009641.5332272.p0 Protein 8e-46 46
Desal_3695 YP_002993280.1 transcriptional regulator NC_013450.8614421.p0 Protein 8e-46 46
Desal_3695 YP_002993280.1 transcriptional regulator NC_007793.3914279.p0 Protein 8e-46 46
Desal_3695 YP_002993280.1 transcriptional regulator NC_002745.1124361.p0 Protein 8e-46 46
Desal_3695 YP_002993280.1 transcriptional regulator HE999704.1.gene2815. Protein 3e-44 44
Desal_3695 YP_002993280.1 transcriptional regulator BAC0197 Protein 2e-32 43
Desal_3695 YP_002993280.1 transcriptional regulator CP001138.1.gene2239. Protein 1e-35 43
Desal_3695 YP_002993280.1 transcriptional regulator AE000516.2.gene3505. Protein 5e-36 43
Desal_3695 YP_002993280.1 transcriptional regulator BAC0596 Protein 1e-35 43
Desal_3695 YP_002993280.1 transcriptional regulator CP000647.1.gene2531. Protein 2e-36 43
Desal_3695 YP_002993280.1 transcriptional regulator NC_002951.3238224.p0 Protein 8e-37 42
Desal_3695 YP_002993280.1 transcriptional regulator NC_007793.3914065.p0 Protein 8e-37 42
Desal_3695 YP_002993280.1 transcriptional regulator NC_002758.1121390.p0 Protein 8e-37 42
Desal_3695 YP_002993280.1 transcriptional regulator NC_010079.5776364.p0 Protein 8e-37 42
Desal_3695 YP_002993280.1 transcriptional regulator NC_002952.2859858.p0 Protein 8e-37 42
Desal_3695 YP_002993280.1 transcriptional regulator NC_007622.3794948.p0 Protein 8e-37 42
Desal_3695 YP_002993280.1 transcriptional regulator NC_003923.1003417.p0 Protein 8e-37 42
Desal_3695 YP_002993280.1 transcriptional regulator NC_013450.8614146.p0 Protein 8e-37 42
Desal_3695 YP_002993280.1 transcriptional regulator NC_012469.1.7686381. Protein 4e-42 42
Desal_3695 YP_002993280.1 transcriptional regulator NC_002695.1.916589.p Protein 4e-36 42
Desal_3695 YP_002993280.1 transcriptional regulator CP000034.1.gene2186. Protein 6e-36 42
Desal_3695 YP_002993280.1 transcriptional regulator CP001918.1.gene3444. Protein 6e-35 42
Desal_3695 YP_002993280.1 transcriptional regulator BAC0039 Protein 6e-36 42
Desal_3695 YP_002993280.1 transcriptional regulator CP001918.1.gene5135. Protein 6e-26 42
Desal_3695 YP_002993280.1 transcriptional regulator AE015929.1.gene1106. Protein 5e-31 41
Desal_3695 YP_002993280.1 transcriptional regulator CP000034.1.gene3834. Protein 1e-29 41
Desal_3695 YP_002993280.1 transcriptional regulator CP001138.1.gene4273. Protein 5e-30 41
Desal_3695 YP_002993280.1 transcriptional regulator BAC0533 Protein 3e-30 41
Desal_3695 YP_002993280.1 transcriptional regulator NC_002695.1.915041.p Protein 1e-29 41
Desal_3695 YP_002993280.1 transcriptional regulator CP000647.1.gene4257. Protein 3e-30 41
Desal_3695 YP_002993280.1 transcriptional regulator CP004022.1.gene1676. Protein 3e-34 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Desal_3695 YP_002993280.1 transcriptional regulator VFG0596 Protein 2e-30 43
Desal_3695 YP_002993280.1 transcriptional regulator VFG1563 Protein 5e-35 42
Desal_3695 YP_002993280.1 transcriptional regulator VFG1702 Protein 2e-34 41