Gene Information

Name : Pjdr2_1503 (Pjdr2_1503)
Accession : YP_003010262.1
Strain : Paenibacillus sp. JDR-2
Genome accession: NC_012914
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1795021 - 1795740 bp
Length : 720 bp
Strand : +
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receiver; KEGG: bha:BH3157 two-component response regulator involved in phosphate regulation

DNA sequence :
ATGTCACATAAAGTGCTCGTTATTGAGGATGAACCGACACTCGCGCGACTTTTGTCGTATAATCTGACGCAAGAGGGTTA
CGATACGACTGTCATTGATCATGGTGCAACCGGGCTTCAGACCGCTTTGCAGCGCAACTTTGATCTCATTATTTTGGACA
TCATGCTGCCAGGCTTGAACGGCTTTGAAATATTAACAAGGCTTCGCCAGAACGGCGTTAAGACGCCTATTATTATTTTG
ACCGCGCGCAATGCGGAGGAAGAAGTCGTTCAAGGGCTGAAGCATGGCGCGGATGACTACATTACGAAGCCGTTTGGCGT
TGCGGAGCTGCTCGCGAGGGTATCTGCCGTATTGCGCCGGACGCAGCAGGATGACAGCGTGCCAATCGAAACGTCGGAGA
AAGTCATTACCGTAGGAGATTTGTCGATTTATCCGGAGAAATACGAAGTTATTCTGAACGGGGAGACCGTTCCGCTTCGT
CCGAAGGAATTCGAAGTGCTGCTGTATCTCGTACAGCGTCCGGGGATGGTTATTACGCGCGATGATTTGATGAACGTGGT
CTGGGGCTTTGACTATATCGGCGGCCAGCGTACGGTTGACGTCCATGTCAGCTCGCTGCGCAAGAAGCTGGAGCTTGGTC
AATCCGTACAGATCGAATCGATTCGCGGCGTCGGTTATAAATTAGTCATGTCAAAAAAACTCGTCACACCAAAGGGATAA

Protein sequence :
MSHKVLVIEDEPTLARLLSYNLTQEGYDTTVIDHGATGLQTALQRNFDLIILDIMLPGLNGFEILTRLRQNGVKTPIIIL
TARNAEEEVVQGLKHGADDYITKPFGVAELLARVSAVLRRTQQDDSVPIETSEKVITVGDLSIYPEKYEVILNGETVPLR
PKEFEVLLYLVQRPGMVITRDDLMNVVWGFDYIGGQRTVDVHVSSLRKKLELGQSVQIESIRGVGYKLVMSKKLVTPKG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 8e-34 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Pjdr2_1503 YP_003010262.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 8e-46 46
Pjdr2_1503 YP_003010262.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 1e-45 46
Pjdr2_1503 YP_003010262.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 1e-45 46
Pjdr2_1503 YP_003010262.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 1e-45 46
Pjdr2_1503 YP_003010262.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 1e-45 46
Pjdr2_1503 YP_003010262.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 1e-45 46
Pjdr2_1503 YP_003010262.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 1e-45 46
Pjdr2_1503 YP_003010262.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 8e-46 46
Pjdr2_1503 YP_003010262.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 1e-45 46
Pjdr2_1503 YP_003010262.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 1e-45 46
Pjdr2_1503 YP_003010262.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 5e-51 46
Pjdr2_1503 YP_003010262.1 winged helix family two component transcriptional regulator NC_012469.1.7686381. Protein 3e-48 45
Pjdr2_1503 YP_003010262.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 2e-38 42
Pjdr2_1503 YP_003010262.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 2e-38 42
Pjdr2_1503 YP_003010262.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 2e-38 42
Pjdr2_1503 YP_003010262.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 2e-38 42
Pjdr2_1503 YP_003010262.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 2e-38 42
Pjdr2_1503 YP_003010262.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 2e-38 42
Pjdr2_1503 YP_003010262.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 2e-38 42
Pjdr2_1503 YP_003010262.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 2e-38 42
Pjdr2_1503 YP_003010262.1 winged helix family two component transcriptional regulator CP001485.1.gene721.p Protein 1e-33 42
Pjdr2_1503 YP_003010262.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 6e-38 42
Pjdr2_1503 YP_003010262.1 winged helix family two component transcriptional regulator AE016830.1.gene1681. Protein 5e-49 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Pjdr2_1503 YP_003010262.1 winged helix family two component transcriptional regulator VFG0596 Protein 3e-34 41