Gene Information

Name : Pjdr2_2638 (Pjdr2_2638)
Accession : YP_003011378.1
Strain : Paenibacillus sp. JDR-2
Genome accession: NC_012914
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 3057573 - 3058271 bp
Length : 699 bp
Strand : +
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receiver; KEGG: bsu:BSU13250 hypothetical protein

DNA sequence :
ATGAATGAACGAGTTCTGGTCGTTGAAGATGAGGCGGGTATTTCCCGCATTTTACAGCTTGAATTAGAGCATGAAGGATA
TACGGTCGGTACAGCAGCCGACGGACGGACAGGTTATGAAATGGCCTCGACAGGCGAATGGGAGCTGGTATTGCTCGATG
TGATGCTTCCCGAATTAAACGGCATTGAAGTGCTTCGCCGTCTGCGGCAGGCCGGCAACCCGGTTCCCGTTATTTTGCTG
ACGGCAAGAGATACGGTACCGGATAAGGTCAGCGGTTTTGAACACGGCGCTAATGACTATATTACAAAGCCGTTTGCGAT
GGAAGAGCTGCTTGCCCGCGTCCGCAATATTTTGCGTATCTTCCAGCAGTACCCGAAAGAATCCGAAGGATCCGACCTGA
TTAAGGTTGGAGATTTAACGATCGAGCTGCGTACCCGCAAGGTATACCGCAAGGAAATCGTTATTGAGCTAACGCCTCGC
GAATTCGAGCTTCTTGTCTATCTGGTCGAGAACAAAAACGAAGAGAAATCGCGGGAAGACATTTTATCGGAAGTATGGGG
TTATGACTTTATCGGGGAAACAAACTTGGTGGACGTCTATATCCGGTACTTGCGCCAAAAGCTGGATAAGGGCTACCGTC
ATAAGCTGATTCATACCGTAAGGGGCGTCGGCTATATGATAAAGGAGCCTGACGCATGA

Protein sequence :
MNERVLVVEDEAGISRILQLELEHEGYTVGTAADGRTGYEMASTGEWELVLLDVMLPELNGIEVLRRLRQAGNPVPVILL
TARDTVPDKVSGFEHGANDYITKPFAMEELLARVRNILRIFQQYPKESEGSDLIKVGDLTIELRTRKVYRKEIVIELTPR
EFELLVYLVENKNEEKSREDILSEVWGYDFIGETNLVDVYIRYLRQKLDKGYRHKLIHTVRGVGYMIKEPDA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 5e-35 44
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 5e-34 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Pjdr2_2638 YP_003011378.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 1e-45 50
Pjdr2_2638 YP_003011378.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 1e-45 50
Pjdr2_2638 YP_003011378.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 1e-45 50
Pjdr2_2638 YP_003011378.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 1e-45 50
Pjdr2_2638 YP_003011378.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 1e-45 50
Pjdr2_2638 YP_003011378.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 1e-45 50
Pjdr2_2638 YP_003011378.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 1e-45 50
Pjdr2_2638 YP_003011378.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 1e-45 50
Pjdr2_2638 YP_003011378.1 winged helix family two component transcriptional regulator HE999704.1.gene1528. Protein 1e-45 50
Pjdr2_2638 YP_003011378.1 winged helix family two component transcriptional regulator BAC0125 Protein 3e-42 47
Pjdr2_2638 YP_003011378.1 winged helix family two component transcriptional regulator BAC0197 Protein 9e-40 46
Pjdr2_2638 YP_003011378.1 winged helix family two component transcriptional regulator AE015929.1.gene1106. Protein 3e-39 45
Pjdr2_2638 YP_003011378.1 winged helix family two component transcriptional regulator BAC0347 Protein 1e-41 45
Pjdr2_2638 YP_003011378.1 winged helix family two component transcriptional regulator BAC0111 Protein 1e-42 44
Pjdr2_2638 YP_003011378.1 winged helix family two component transcriptional regulator BAC0083 Protein 1e-41 44
Pjdr2_2638 YP_003011378.1 winged helix family two component transcriptional regulator BAC0308 Protein 3e-40 44
Pjdr2_2638 YP_003011378.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 7e-42 44
Pjdr2_2638 YP_003011378.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 5e-42 44
Pjdr2_2638 YP_003011378.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 5e-42 44
Pjdr2_2638 YP_003011378.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 5e-42 44
Pjdr2_2638 YP_003011378.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 7e-42 44
Pjdr2_2638 YP_003011378.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 5e-42 44
Pjdr2_2638 YP_003011378.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 5e-42 44
Pjdr2_2638 YP_003011378.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 5e-42 44
Pjdr2_2638 YP_003011378.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 5e-42 44
Pjdr2_2638 YP_003011378.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 5e-42 44
Pjdr2_2638 YP_003011378.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 1e-45 44
Pjdr2_2638 YP_003011378.1 winged helix family two component transcriptional regulator AF155139.2.orf0.gene Protein 4e-33 43
Pjdr2_2638 YP_003011378.1 winged helix family two component transcriptional regulator BAC0638 Protein 2e-37 43
Pjdr2_2638 YP_003011378.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 8e-36 42
Pjdr2_2638 YP_003011378.1 winged helix family two component transcriptional regulator AE016830.1.gene1681. Protein 9e-43 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Pjdr2_2638 YP_003011378.1 winged helix family two component transcriptional regulator VFG0596 Protein 2e-35 44
Pjdr2_2638 YP_003011378.1 winged helix family two component transcriptional regulator VFG1390 Protein 2e-44 43
Pjdr2_2638 YP_003011378.1 winged helix family two component transcriptional regulator VFG1386 Protein 3e-42 43
Pjdr2_2638 YP_003011378.1 winged helix family two component transcriptional regulator VFG1389 Protein 4e-42 42