Gene Information

Name : PC1_2890 (PC1_2890)
Accession : YP_003018452.1
Strain : Pectobacterium carotovorum PC1
Genome accession: NC_012917
Putative virulence/resistance : Virulence
Product : hypothetical protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 3266883 - 3267203 bp
Length : 321 bp
Strand : +
Note : PFAM: protein of unknown function DUF1219; KEGG: eca:ECA2853 hypothetical protein

DNA sequence :
ATGCAAACAACACCTGCAATCCAGTCACGGGAGGATCAGTCTTGCCCGTCACCTGTAACCGTCTGGCAGCAACTGCTGAC
CTATCTACTGGAAAAGCACTACGGCCTGACACTGAACGACACACCGTTCTGTGAAGAAAACGTGATTCAGGCGCATATCG
ATGCTGGTATCACGCTGGTCAATGCCGTCAATTTTCTGGTGGAAAAATACGAACTGGTGCGTATTGATCGCAACGGCTTT
AACTGGCAGGAGCAATCACCGTTTCTCACGACTGTCGATATCCTTCGCGCCAGACGTGCAACGGGCTTACTTAAGGCATA
A

Protein sequence :
MQTTPAIQSREDQSCPSPVTVWQQLLTYLLEKHYGLTLNDTPFCEENVIQAHIDAGITLVNAVNFLVEKYELVRIDRNGF
NWQEQSPFLTTVDILRARRATGLLKA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAI43848.1 hypothetical protein Not tested LEE Protein 8e-29 63
aec76 AAW51759.1 Aec76 Not tested AGI-3 Protein 8e-29 63
ECO103_3592 YP_003223449.1 hypothetical protein Not tested LEE Protein 9e-30 63
yeeV YP_854325.1 hypothetical protein Not tested PAI I APEC-O1 Protein 7e-30 63
yeeV CAE85204.1 YeeV protein Not tested PAI V 536 Protein 5e-29 63
unnamed AAL67342.1 intergenic-region protein Not tested PAI II CFT073 Protein 5e-29 63
z5091 CAD33789.1 Z5091 protein Not tested PAI I 536 Protein 1e-28 62
yeeV NP_708773.1 hypothetical protein Not tested SHI-1 Protein 9e-30 62
unnamed AAK00482.1 unknown Not tested SHI-1 Protein 6e-30 62
unnamed AAL67389.1 L0007-like protein Not tested PAI II CFT073 Protein 3e-28 62
unnamed CAD42101.1 hypothetical protein Not tested PAI II 536 Protein 3e-28 62
yeeV ADD91699.1 YeeV Not tested PAI-I AL862 Protein 4e-28 62
c5149 NP_756997.1 hypothetical protein Not tested PAI II CFT073 Protein 4e-28 62
yeeV NP_838487.1 hypothetical protein Not tested SHI-1 Protein 9e-30 62
unnamed AAL57575.1 unknown Not tested LEE Protein 3e-29 62
unnamed AAL08478.1 unknown Not tested SRL Protein 1e-27 61
Z5091 NP_290242.1 hypothetical protein Not tested LEE Protein 4e-28 61
ECs4539 NP_312566.1 hypothetical protein Not tested LEE Protein 4e-28 61
unnamed AAC31486.1 L0007 Not tested LEE Protein 3e-28 61
unnamed ACU09433.1 conserved hypothetical protein Not tested LEE Protein 3e-28 61
unnamed CAD66207.1 hypothetical protein Not tested PAI III 536 Protein 1e-27 61

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
PC1_2890 YP_003018452.1 hypothetical protein VFG1530 Protein 5e-29 62
PC1_2890 YP_003018452.1 hypothetical protein VFG1620 Protein 1e-28 62
PC1_2890 YP_003018452.1 hypothetical protein VFG0663 Protein 3e-30 62
PC1_2890 YP_003018452.1 hypothetical protein VFG1069 Protein 6e-28 61
PC1_2890 YP_003018452.1 hypothetical protein VFG0786 Protein 1e-28 61
PC1_2890 YP_003018452.1 hypothetical protein VFG1682 Protein 6e-28 61